(data stored in SCRATCH zone)

EMBL: CP001163.GSPE

CP001163.GSPE        Location/Qualifiers
FT   CDS_pept        84177..85682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="ECH74115_B0004"
FT                   /product="general secretory pathway protein E"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR02533"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34497"
FT                   /protein_id="ACI34497.1"
FT                   /translation="MSRVVQNVSESRPLLPFSFSRTQRILLLREQEGNRVFCMEDTPAS
FT                   ALLEVRRVAEGPLNVTTVSAEAFEKQLVSSYQRDSDEARQMMAEIGNEMDFYTVAGELP
FT                   DREDLLDANDDAPIIRLINAMLTEAIKEKASDIHIETYERHLQVRFRIDGVLREILRLH
FT                   RNLASLLISRIKVMARLDIAEKRVPQDGRMVLRIGGRAVDVRVSTLPSNHGERIVLRLL
FT                   DKNSVSLDLAALGMSQQNQRHIDALIRRPHGIILVTGPTGSGKSTTLYAALSLLNPRDR
FT                   NIMTVEDPVEYELDGISQTQVNPKVDMTFARSLRAILRQDPDVVLVGEIRDGETAQIAV
FT                   QASLTGHLVLSTLHTNSAAGALSRLQDMGIPPFLLSTSLLAVLAQRLVRTLCPRCRQPC
FT                   QVSTELAMDMDIPPETTIWQPAGCQHCSFTGYHGRTGIHELLLIDDRIRTAIYQGEGEL
FT                   GITRLAGSRYLTLRGDGRQKVLAGETSWEEVVRVTESRLQEEE"
     atgagcagag tagtacagaa tgtcagtgaa tcacgtcccc ttctgccttt ttccttttcc        60
     cgtacgcaga gaattttgtt gctgcgtgaa caggagggga atcgagtgtt ctgcatggag       120
     gacacacctg ccagtgccct gttggaggtg cgcagggtgg ctgaaggtcc tctgaatgtc       180
     acaacagtgt cggcggaagc gtttgaaaaa cagctggtga gcagctatca acgtgattct       240
     gatgaagcgc gacaaatgat ggctgagatt ggtaatgaaa tggattttta taccgtcgca       300
     ggggagttgc ctgaccgtga ggacttactg gatgcgaatg acgatgcgcc aattatccgc       360
     ctgattaacg caatgctgac agaggcaatt aaagagaaag cctcagatat tcatattgaa       420
     acttacgaac gccatctgca ggttcgcttt cgcattgatg gcgttctgcg ggagatcctc       480
     cgtttacata ggaatctggc ttcgttactg atttcacgca ttaaagtcat ggcccggttg       540
     gatattgccg aaaaacgcgt tccccaagat ggccgcatgg tactgcgtat cggtggtcgg       600
     gcggtggatg tgcgtgtttc aacgttgcct tcaaatcatg gtgaacgcat cgtgctgcgt       660
     ttactagaca aaaatagcgt tagtctcgat cttgctgcac tcggcatgtc gcagcagaat       720
     cagcgacaca ttgatgcact gatccgccgt cctcacggca ttattttggt gaccgggcct       780
     acagggtcgg gtaaaagcac gacgctttat gccgcgttaa gcctgctgaa tccccgagac       840
     cgcaacatta tgacggtcga ggatcctgtt gaatatgaac tggacggtat cagtcagacc       900
     caggtcaacc cgaaggtgga catgaccttt gcccggagtc tgcgcgctat tttacgtcag       960
     gatccggacg tggtgcttgt gggggagatc cgtgacggtg aaacagccca gattgctgtg      1020
     caggcctcgc tgacagggca tttggtgctg tcaacgttac atacgaatag tgcagcaggc      1080
     gcgctgtcgc gtctgcagga tatgggcatc cctccttttc tgctttccac ctcattactg      1140
     gctgttctgg cccagcgact ggttcgcacg ttgtgtccgc gctgtcgtca gccctgtcag      1200
     gtcagtactg agttagcgat ggacatggac attccccctg aaaccacgat ctggcagcct      1260
     gccgggtgtc agcactgcag tttcacgggc tatcacgggc gcaccgggat ccacgagctg      1320
     ttgctgattg acgatcgcat tcggacggca atctatcagg gggaggggga gctgggtatt      1380
     acccgcttgg cagggagtcg ctatctgacg ctgcgtggcg acgggcgaca aaaggtacta      1440
     gccggtgaga ccagttggga ggaggtggtt cgcgttactg aaagcagatt gcaggaagag      1500
     gaatga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page