(data stored in SCRATCH zone)

EMBL: CP001163.GSPF

CP001163.GSPF        Location/Qualifiers
FT   CDS_pept        85684..86907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="ECH74115_B0005"
FT                   /product="general secretion pathway protein F"
FT                   /note="identified by match to protein family HMM PF00482;
FT                   match to protein family HMM TIGR02120"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34502"
FT                   /protein_id="ACI34502.1"
FT                   /translation="MALFHYQASDIHGRKRSGILEADSARHARQLLREQALIPVRLDEK
FT                   QVHHKHSLRSILRFRPRGGSSAELALLTRQLATLVAASLPLEEALDALLRQSEKPRQRN
FT                   LIAAVRTKVLEGHSLAAAMGMFPGTFERLYCAMVAAGETSGRLDVVLSRLADYTEQRQI
FT                   MRNRLLQALLYPCVLTLVAVGVIAILLTAVVPKVVEQFIHMKQTLPLSTRVLMGAAEVS
FT                   QTWGPWLLLAAALGGIAGRMILHQPSQRLAFHHLLLRLPVVGRISRGLNTARYARTLSI
FT                   LNASAVPLLQAMHISGDVLSNDWARHQLATAAELVREGVSLHQALEQTSLFPPMMRHMI
FT                   ASGENSGELDSMLERAADNQDREFSTQMQLALGLFEPLLVVGMAGVVLFIVLAILQPLL
FT                   QLNNMMNM"
     atggcgttgt ttcattatca ggcatcagat attcacggta gaaaacgcag tggcattctg        60
     gaggcggatt cggcccgaca tgcccgtcag ttgctgcgtg agcaggcgct tattccagtc       120
     aggttggatg agaaacaggt ccatcacaag cactcactgc ggagtatcct gaggtttcgt       180
     ccgcgcgggg ggagcagcgc cgaactcgcg ttactgacac ggcagttagc cacactagtg       240
     gccgcatctc tgccgcttga agaggcgctg gatgcgttgt tgaggcagag tgaaaaaccg       300
     cgtcagcgga acttaatcgc tgccgtgcgc accaaggttc tcgagggaca ttccttggcc       360
     gcggcgatgg gcatgtttcc aggtacgttt gagcgtcttt attgtgcgat ggtggcggcg       420
     ggggaaacat ccggtcgttt ggacgtggtg ctcagtcgtc tggctgacta taccgagcag       480
     cgccagatca tgcgaaaccg tctactccag gcattgctct atccttgtgt tctgacgttg       540
     gtggcggttg gggttattgc cattctgctt actgcggttg tgccgaaagt ggttgagcag       600
     tttattcata tgaaacagac ccttccctta tctacccgcg tactgatggg ggctgctgag       660
     gtgagccaga cttggggccc gtggctgtta ctggccgcag cgctgggcgg gatagcgggg       720
     cgcatgatat tacatcagcc ctcccagcgt ctggcttttc atcatctgct gttgcggctg       780
     ccggtcgtgg ggcgcatatc gcgcggtctg aataccgcac gttatgcccg cacgctgagc       840
     attcttaatg ccagtgcggt accgctgctc caggcgatgc acatcagtgg tgacgtactg       900
     agtaatgact gggcccgtca tcagttagct accgcggccg agttggttag ggaaggggtc       960
     agcctgcatc aggcactgga gcagacttcg ctgtttccgc ctatgatgcg gcacatgatt      1020
     gccagcggtg aaaatagtgg cgaactcgac agcatgttgg aacgggccgc cgacaatcag      1080
     gatcgtgagt tcagcacaca gatgcaactg gcgctgggat tgtttgaacc gctgttggtg      1140
     gtgggtatgg ccggggtcgt tttgtttatt gttctggcaa ttctgcagcc gctcctgcag      1200
     ctcaacaaca tgatgaatat gtga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page