(data stored in SCRATCH zone)

EMBL: CP001163.GSPG

CP001163.GSPG        Location/Qualifiers
FT   CDS_pept        86938..87372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="ECH74115_B0006"
FT                   /product="general secretion pathway protein G"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM PF08334; match to protein
FT                   family HMM TIGR01710; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34464"
FT                   /protein_id="ACI34464.1"
FT                   /translation="MRKQHQRGFTLLEIMVVIVILGVLASLVVPNLMGNKDKADRQKVM
FT                   SDLVALESTLDMYRLDNNRYPTTEQGLRALVSKPTVQPEPRNYRQDGYIRRLPQDPWGG
FT                   DYQLLNPGQYSDIDIFSPGPDGVPNTEDDIGNWTLGNAQP"
     atgcgaaaac agcatcagcg tggttttacc ttgctggaaa taatggtggt aattgtgatc        60
     ttgggagttt tggccagtct ggtggtcccg aatctgatgg gaaataagga taaggccgat       120
     cggcagaaag tgatgagcga cttggttgcg ctggaaagca cgctcgatat gtaccggtta       180
     gataataacc ggtatccgac aacggagcag ggactgcggg cactggtcag taaacccacc       240
     gtgcaacctg aaccccgtaa ctaccggcag gatggttata tccgccgttt gccccaggat       300
     ccttgggggg gggattatca gctgttaaat cctggtcagt acagcgacat tgatatcttt       360
     tctcctggcc cggatggtgt gccaaacact gaagatgata ttggtaactg gacgctcggt       420
     aacgcgcagc catga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page