(data stored in SCRATCH zone)

EMBL: CP001163.GSPH

CP001163.GSPH        Location/Qualifiers
FT   CDS_pept        87369..87923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="ECH74115_B0007"
FT                   /product="general secretion pathway protein H"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR01708; match to protein
FT                   family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34475"
FT                   /protein_id="ACI34475.1"
FT                   /translation="MSQRGFTILEMMLILLLMGITAGLVLMSFPDSAQNHLQQQRERLQ
FT                   AQLDYALDRSQQDGLLMGIQVRFDGWKFKVLQRGTAESPPTLAEGGDIWQGYVWQTWQP
FT                   RRAAMGGKLPDDVRLELQYLRGLQWMSEHDDGAEPDILLLPGGEVTPFRLLFRQVGEEA
FT                   VVGLQVDENGLMTLFEGEVSL"
     atgagtcagc gcggtttcac aatactggag atgatgctga tccttttgtt gatgggcatc        60
     actgcagggc tggtactaat gtcatttcct gactctgctc agaatcatct gcaacaacag       120
     cgggagcgtc tgcaggcgca gctggattat gccttggata gaagccagca ggacggcttg       180
     ctgatgggga ttcaggttcg gtttgacgga tggaaattta aggttctgca gcgcggaaca       240
     gcggaaagcc ccccgacatt agctgaggga ggggatattt ggcaggggta tgtctggcaa       300
     acttggcaac cgcgacgtgc agccatgggg ggcaaacttc cggatgatgt gcgtcttgag       360
     ctgcagtatc tcagaggttt gcagtggatg tctgagcatg atgacggggc tgaacccgat       420
     attttgctgc ttcccggagg tgaggtaacg ccgttcagac ttcttttcag gcaggtcgga       480
     gaggaggccg ttgtcgggct gcaggttgat gagaacggtt tgatgactct ttttgaaggt       540
     gaggtctcat tgtga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page