(data stored in SCRATCH zone)

EMBL: CP001163.GSPI

CP001163.GSPI        Location/Qualifiers
FT   CDS_pept        87920..88285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="ECH74115_B0008"
FT                   /product="general secretion pathway protein I"
FT                   /note="identified by match to protein family HMM PF02501;
FT                   match to protein family HMM PF07963; match to protein
FT                   family HMM TIGR01707; match to protein family HMM
FT                   TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34488"
FT                   /protein_id="ACI34488.1"
FT                   /translation="MKGQEGMTLLEVIVALVVFALAGMALMQASTQQAAGIGRMEEKVL
FT                   AGWLADNQMVQLQLEKTWPENGWGEKTISFAGTEWYLRWGGPDSDVPQPRSLEVEVRRT
FT                   KEETSALVSLRSSVVRE"
     gtgaaggggc aagaaggaat gacattactg gaagtcatag tagctctggt tgtgtttgcg        60
     ctggcaggaa tggcgctgat gcaggcctcg acccagcagg ctgcggggat cggacggatg       120
     gaagagaagg tgctggcagg ctggttggcc gataaccaga tggtgcaatt gcaactcgag       180
     aaaacttggc cggaaaatgg ctggggcgag aagacgatca gcttcgctgg caccgaatgg       240
     tatttacgct ggggcgggcc ggacagcgac gtgccgcagc cgcgctcctt agaggtagag       300
     gtacggcgca ctaaagagga gacgtccgcc ttggtttcct tgcgtagcag tgtggttcgt       360
     gaatga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page