(data stored in SCRATCH zone)

EMBL: CP001163.GSPJ

CP001163.GSPJ        Location/Qualifiers
FT   CDS_pept        88282..88881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="ECH74115_B0009"
FT                   /product="general secretion pathway protein J"
FT                   /note="identified by match to protein family HMM PF07963;
FT                   match to protein family HMM TIGR01711; match to protein
FT                   family HMM TIGR02532"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34455"
FT                   /protein_id="ACI34455.1"
FT                   /translation="MSQQRVKGFTLLEMLLALAVFAALSISAFQVLQGGIRAHELSRDK
FT                   VQRLAELQRGISQMERDLTQMLPRHSRGNEGLLLAAPHLLKSDDWGISFTRNSWLNPAG
FT                   MLPRPELQWVGYRLRQQKLERLSYFHVDHPSGVSPDVRVMLDGVHAFRLRFFVNGDWQA
FT                   RWDSTGILPQAVEVTLVMDDFAELPRLFLVSKETAE"
     atgagtcagc aacgggtaaa aggttttacg ctactggaaa tgctgttggc actggctgtt        60
     tttgcagcgt tgagcatcag cgcatttcag gtgctgcagg gtggaatacg ggcgcacgag       120
     ctgtcccggg ataaagtaca gcgtctggct gagctgcaga gagggatcag ccagatggag       180
     cgagatctta cgcagatgct cccaaggcac agccggggga atgaaggcct gctgctcgct       240
     gcacctcatc tgctaaaaag tgatgactgg gggatttctt ttacgcgaaa cagctggctg       300
     aatcccgccg ggatgctgcc gcgcccggag ttacagtggg taggttatcg gttgcgacag       360
     caaaagttag aacgcctgag ctactttcat gtcgatcacc cttccggtgt ttctccggat       420
     gtcagggtga tgctggacgg cgttcacgca tttcgtctgc gtttttttgt taacggtgat       480
     tggcaggcgc gctgggacag taccggcatc ctgccgcagg ctgttgaagt gacgctggtt       540
     atggatgatt ttgctgaact gccccgtctg tttcttgtga gcaaggagac cgctgaatga       600
//

If you have problems or comments...

PBIL Back to PBIL home page