(data stored in SCRATCH zone)

EMBL: CP001163.GSPK

CP001163.GSPK        Location/Qualifiers
FT   CDS_pept        88878..89855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="ECH74115_B0010"
FT                   /product="general secretion pathway protein K"
FT                   /note="identified by match to protein family HMM PF03934"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34479"
FT                   /protein_id="ACI34479.1"
FT                   /translation="MKLREQGVALLVVLLILSLMVTIAAVIAERNGRTFLRTVAQLDQL
FT                   QAKWDGYTAETIAKQILQRSRQESPRKTHLAQNWAQSERQFETRGGDVRGQIVDAQACF
FT                   NLNAINYGVVDLTSIPYAARIFQQLLINLQVELLQARQVTAALRDWIDRDDKPVRGGAE
FT                   DEVYMGMEPPYLAANQPMQDVSELRLIRGIDARLYRKLLPYVCVLPTSDLSVNVNTLLD
FT                   SQAPLLAALFLTKPDSLPVTELLQRRPRTGWESVAAFLDAPPLKDIDTSAAMPVLAVSS
FT                   NYFLVRLHVRSGEHLFSQQTLMQWREERFRIIQRQYGLTMREVP"
     atgaaattgc gggaacaggg cgtggcgctt ctggtggtat tgctgatcct gtcgttaatg        60
     gtaacgatag cggcggtgat tgcggagcgc aacggtcgga catttttgcg tacagtagcg       120
     cagttggatc agctgcaggc aaagtgggat ggctatacgg cagagacgat agcaaaacaa       180
     atcttacaga ggagcaggca ggagtcgccc cggaaaacgc atctggcaca aaattgggcg       240
     cagtcagaac gacagtttga gaccagaggg ggagatgtgc gggggcagat cgtggatgcg       300
     caggcctgtt ttaatcttaa tgctattaat tatggagtgg tggatctgac cagtatacct       360
     tatgccgcca gaatttttca gcagctatta atcaacttgc aggtagagct tttacaggcc       420
     cggcaagtga cggcagccct acgtgactgg atcgatcgtg atgataagcc ggtaaggggc       480
     ggtgctgaag acgaggtgta tatggggatg gaacctccct atctggcagc caaccagccg       540
     atgcaggacg tcagtgagtt acgccttatc cggggaatag atgccaggct ttaccgcaaa       600
     cttttgccgt atgtttgtgt actgcctacg tcagatctgt ctgtgaatgt gaatactctg       660
     ctggattcac aggcgccgct gctggcggcg ctctttctga cgaaaccgga cagtcttccg       720
     gtgacggaat tactgcagcg gcgaccccgt actggttggg agagcgtggc ggcgtttctt       780
     gacgcgccac cgcttaagga cattgacacc agtgcggcca tgccggtatt ggccgtcagc       840
     agcaactatt ttctggttcg gttacatgtg cgctccgggg aacacctgtt cagtcagcag       900
     actttaatgc agtggaggga ggagcgtttc cggatcattc agcgacagta tggattaacg       960
     atgagggagg ttccctga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page