(data stored in SCRATCH zone)

EMBL: CP001163.GSPL

CP001163.GSPL        Location/Qualifiers
FT   CDS_pept        89927..91066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="ECH74115_B0011"
FT                   /product="general secretion pathway protein L"
FT                   /note="identified by match to protein family HMM PF05134;
FT                   match to protein family HMM TIGR01709"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34435"
FT                   /protein_id="ACI34435.1"
FT                   /translation="MWRLIAPEETGAGSVAVGETDPQLVGLLSRYPAWVLVPSGRIAFH
FT                   QVTLPHRTWRQRLQVLPFLLEEQLATDIEQLHFAILHQSGDRCDVAVVEKAVMHRWLAY
FT                   CGQLGVREVRLLPDVLMLPLATEGWSAVKLAGQWLFRRDRYAGMTVELSWLTHFLSLTA
FT                   PPVIESYSVPPVPCPGPKTTEWRNQPGRDLLQLVAEGDGYDGADLRQGEFARQGTWYAR
FT                   FRPWRYVAGALLACVFLAGSNAGLAHYRLWQQAQFWRYESVRVYQQLFPSEKAVKDPRR
FT                   QMLRHLQQSTGNNIPELGSVMRQLQQLLSETSTIRLQALAWDSSSQTLKIDLQAASFQA
FT                   LEHFQQIAGEKYLIQPGEIRQQPQGVESRLILRVNNERA"
     ttgtggaggc tgattgcgcc agaggagaca ggagccggca gtgtggcagt cggagaaacg        60
     gatccgcagt tagtcggttt gctgtcccgt tatcccgcct gggtgctggt tccgtcaggc       120
     agaattgcct tccatcaggt cacgctgcca caccgcacgt ggcgtcagcg tttgcaggtg       180
     ctgccctttc ttctggaaga gcagttggcg acagacattg agcagctgca cttcgccatt       240
     cttcatcagt cgggtgacag gtgtgatgtg gcggtggtcg aaaaagcggt tatgcatcgc       300
     tggttagcgt actgtggaca acttggggtt cgggaggtga ggttgctgcc tgacgtactg       360
     atgctgccgt tggcaactga aggatggagt gccgtaaagc ttgccgggca gtggctgttt       420
     cgccgggatc gttacgccgg gatgacggta gagttatcgt ggctgacaca tttcttgtct       480
     cttactgcgc cgccggtgat tgagtcctac tccgtgccgc cagtaccgtg cccgggtccg       540
     aagaccactg agtggcgaaa tcagcccgga cgcgatctgc tgcagttggt ggccgaaggt       600
     gacgggtatg atggcgcaga tctgcggcag ggagaatttg cccgccaggg aacatggtat       660
     gcacgatttc gcccatggag gtatgtcgca ggggctctgc tggcctgtgt ttttctggcc       720
     gggagcaacg cggggctggc acattatcgg ctctggcagc aggctcaatt ctggcggtat       780
     gagagcgtac gtgtctatca gcagctgttt ccgagtgaaa aggcggtgaa ggatccccgc       840
     cggcagatgc tgagacatct gcaacagtcg acgggtaaca atataccgga actcgggagc       900
     gtgatgcgcc agcttcagca actgctgtca gaaacctcaa cgatacgctt acaggcactc       960
     gcctgggaca gcagcagcca gacactgaaa attgatttgc aggcggcttc ttttcaggcg      1020
     ctggaacact ttcagcagat cgccggagaa aaatacctca tccagcctgg tgagatacga      1080
     cagcagccgc agggggtaga aagtcgtctg atcctgagag tgaacaatga acgagcttaa      1140
//

If you have problems or comments...

PBIL Back to PBIL home page