(data stored in SCRATCH zone)

EMBL: CP001163.KATG

CP001163.KATG        Location/Qualifiers
FT   CDS_pept        60441..62651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="ECH74115_B0099"
FT                   /product="catalase/peroxidase HPI"
FT                   /note="identified by match to protein family HMM PF00141;
FT                   match to protein family HMM TIGR00198"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34426"
FT                   /protein_id="ACI34426.1"
FT                   /translation="MIKKTLPVLILLALSGSFSTAVAADKKETQNFYYPETLDLTPLRL
FT                   HSPESNPWGADFDYATRFQQLDMEALKKDIKDLLTTSQDWWPADYGHYGPFFIRMAWHG
FT                   AGTYRTYDGRGGASGGQQRFEPLNSWPDNVNLDKARRLLWPVKKKYGSSISWGDLMVLT
FT                   GNVALESMGFKTLGFAGGREDDWESDLVYWGPDNKPLADNRDKNGKLQKPLAATQMGLI
FT                   YVNPEGPGGKPDPLASAKDIREAFSRMAMDDEETVALIAGGHTFGKAHGAASPEKCIGA
FT                   GPDGAPVEEQGLGWKNKCGTGNGKYTITSGLEGAWSTSPTQFTMQYLKNLYKYEWELHK
FT                   SPAGAYQWKPKKAANIVQDAHDPSVLHPLMMFTTDIALKVDPEYKKITTRFLNDPKAFE
FT                   QAFARAWFKLTHRDMGPAARYLGNEVPAESFIWQDPLPAADYTMIDGKDIKSLKEQVMD
FT                   LGIPASELIKTAWASASTFRVTDYRGGNNGARIRLQPEINWEVNEPEKLKKVLASLTSL
FT                   QREFNKKQSDGKKVSLADLIVLSGNAAIEDAARKAGVELEIPFTPGRTDASQEQTDVAS
FT                   FSVLEPTADGFRNYYSKSRSHISPVESLIDKASQLDLTVPEMTALLGGLRVMDINTNNS
FT                   SLGVFTDTPGVLDNKFFVNLLDMSTRWSKADKEDTYNGFDRKTGALKWKASSVDLIFSS
FT                   NPELRAVAEVYASDDARNKFIHDFVKSWNKVMNSDRFDLNNK"
     atgataaaaa aaactcttcc tgttctgatt cttctggcgc tatcggggag cttttctacc        60
     gctgtagccg ctgataaaaa agagactcaa aatttctact atccagaaac actggattta       120
     actcctctga gattacacag ccctgaatca aatccctggg gggctgattt tgattatgcc       180
     accagatttc aacagctgga tatggaggct ctgaaaaaag atatcaaaga tttgctgaca       240
     acttcccagg attggtggcc tgcggattat ggtcattatg gtcctttctt tattcgtatg       300
     gcttggcacg gtgccggaac atacaggaca tatgatggcc ggggaggcgc cagtggtggt       360
     cagcaacgtt ttgaaccgct gaacagctgg ccggataacg ttaatctgga taaagcccgt       420
     cgattgctgt ggccagtcaa gaaaaaatac ggctccagta tttcctgggg agacctgatg       480
     gtcctgactg gtaatgttgc ccttgaatcc atgggattta aaacgctggg atttgctggc       540
     ggaagagaag atgactggga gtcggacctg gtatactggg ggcctgacaa caagcctctt       600
     gcagataacc gggataaaaa cgggaaactt cagaaacctc ttgccgccac gcagatggga       660
     cttatttatg tcaatcctga aggccccggt ggaaaaccag atcctctggc ttccgcgaaa       720
     gatatcaggg aagctttttc acgtatggcc atggatgatg aggagactgt ggccctgatc       780
     gcgggagggc atacatttgg taaagcacat ggtgcagcgt ctcctgaaaa atgtattggc       840
     gcagggcctg atggtgcacc tgtggaggag cagggactgg gatggaaaaa taaatgtggt       900
     acaggaaacg gcaaatatac catcaccagt ggcctggaag gagcctggtc gacatcgcca       960
     acccagttca caatgcagta tctgaagaat ttatataaat atgaatggga gctgcacaag      1020
     agtcctgccg gtgcttatca gtggaagcct aaaaaagcgg caaatatagt tcaggacgcg      1080
     catgatccgt ctgtcctgca tccgttgatg atgtttacga cggatattgc tcttaaagtt      1140
     gatcctgaat ataagaaaat aaccacccgt ttcctgaatg atccaaaagc ttttgagcag      1200
     gcattcgcaa gagcatggtt taaactgacc caccgggata tgggaccggc agcccgatat      1260
     cttggtaatg aagttcctgc agaatcattt atctggcagg atcctcttcc tgcggcggat      1320
     tatacaatga ttgatggtaa agacattaag tcgctgaaag agcaggttat ggatttgggt      1380
     atccctgcat ctgagctgat aaagacagcc tgggcttcag cttccacatt tcgtgtgact      1440
     gattatcgtg ggggaaataa tggtgcccgc atcaggttac agcccgaaat taactgggaa      1500
     gttaatgagc ctgaaaaact gaagaaagta ctggcatccc tgacctcatt acagcgtgaa      1560
     tttaacaaaa aacagtctga cggaaagaaa gtgtcgttgg ctgatttaat tgttctttcg      1620
     ggtaatgctg caatcgaaga tgcggccaga aaagccgggg tggaacttga gattcccttt      1680
     actccgggaa gaactgacgc ctctcaggag cagacggatg ttgcctcatt cagtgtactg      1740
     gagccgacag cagatggatt cagaaattat tactcaaaaa gcagaagtca tatatcgccg      1800
     gttgaaagcc tcattgataa agccagtcag ctggatctca ccgttcctga aatgacggca      1860
     ttactgggtg gtctgcgggt aatggatatt aatacaaata attcttcgtt gggagtgttt      1920
     accgataccc ctggtgttct ggataacaag ttttttgtta atctgctgga tatgtcaaca      1980
     cgatggagta aagcagataa agaagataca tacaatggat tcgatcgtaa aacgggagca      2040
     ttaaaatgga aagcatcctc tgttgattta atcttcagtt caaatcctga attacgtgcg      2100
     gtggcagaag tatatgcctc ggatgatgcg agaaataagt ttattcatga ttttgttaaa      2160
     tcgtggaata aagttatgaa tagcgatcgg tttgatttaa acaataaatg a               2211
//

If you have problems or comments...

PBIL Back to PBIL home page