(data stored in SCRATCH zone)

EMBL: CP001163.MSBB

CP001163.MSBB        Location/Qualifiers
FT   CDS_pept        74170..75201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msbB"
FT                   /locus_tag="ECH74115_B0114"
FT                   /product="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
FT                   acyltransferase"
FT                   /note="identified by match to protein family HMM PF03279;
FT                   match to protein family HMM TIGR02208"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34445"
FT                   /protein_id="ACI34445.1"
FT                   /translation="MFSSAVRWPPGMVPPSAVLCYHNEISRQIPVNMKNIRTEFIPRFN
FT                   LTLCFPRYWMTWTGIGIICVFAMVPPALRDPLLGKLGMLVGRLGKSARQRALINLSLCF
FT                   PEYSDKEKENIVDAMFATASMAVVLMAELALSGPDKISHRIRWNGLEIVEKMAQNNEKV
FT                   IFLVPHAWGVDIPAMLMAASGRKMAAMFHNQRNPVVDYVWNSVRRRFGGKLHARNDGIA
FT                   SFVRSVRQGYWGYYLPDQDHGPEFSEFADFFATYKATLPVIGRLSRISGARIIPLFPVY
FT                   DGKTHHLTIHVSPPLAIRQKSDAHIARQINEVVENFVRPHPEQYTWILKLLKTRKEGEE
FT                   DPY"
     gtgttttcct ctgctgtccg gtggcctcca gggatggtac caccttctgc tgtactctgt        60
     tatcataatg agataagcag gcagataccg gtaaatatga aaaatatcag aactgagttt       120
     attccccgct ttaaccttac attatgcttc ccccgttact ggatgacgtg gacaggtatc       180
     ggtattatct gtgtgtttgc aatggtcccc cccgcactga gagatccatt gttgggaaaa       240
     ttgggcatgc tggttgggcg tctggggaaa agcgcacgtc aacgggcctt gattaattta       300
     tcgctttgtt ttccggagta cagtgataaa gaaaaggaga atatcgttga tgccatgttt       360
     gcaacagcct ccatggccgt tgtgcttatg gctgaattag cactgtccgg gcctgataaa       420
     atttcgcatc gtatacgctg gaatggtctg gagattgtgg agaagatggc acagaacaat       480
     gaaaaggtca tttttcttgt gccacatgcc tggggagtgg atattcccgc aatgctgatg       540
     gctgcgtcgg gcagaaaaat ggcagcgatg tttcataacc agagaaatcc ggtggtggat       600
     tatgtctgga acagtgttcg tcgtcgtttc ggaggaaaac tgcacgcacg taatgacggt       660
     attgcctcct ttgtccgctc agtccggcag ggatactggg gatattatct tcctgatcag       720
     gatcatggcc cggaattcag tgagtttgca gatttttttg cgacgtataa agcaacttta       780
     ccggttatcg gacggctcag caggatcagt ggtgcacgga taataccgct tttccctgtt       840
     tatgacggaa agacccatca tctgactatt catgtcagcc cgccacttgc tatacgacag       900
     aagagtgatg ctcatattgc gcgacagata aacgaagtgg ttgaaaattt cgttcgtcca       960
     catcctgagc agtatacgtg gatcctcaag ttgctgaaaa cgcgtaaaga aggggaagag      1020
     gatccttact ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page