(data stored in SCRATCH zone)

EMBL: CP001163.PE1

CP001163.PE1         Location/Qualifiers
FT   CDS_pept        196..711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0017"
FT                   /product="hemolysin-activating lysine-acyltransferase HlyC"
FT                   /note="identified by match to protein family HMM PF02794"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34481"
FT                   /protein_id="ACI34481.1"
FT                   /translation="MKSNAFDVMGKVAWLWACSPLHKKWPLSVFAINVIPAIQTNQFAL
FT                   LIKDELPVAFCSWASLDLECEVKYINDVTSLYAKDWMSGERKWFIDWIAPFGHNMELYK
FT                   YMRKKYPYELFRAIRLDESSKTGKIAEFHGGGIDKKLASKIFRQYHHELMSEVKNRQDF
FT                   NFNIEKEN"
     atgaaatcta atgcttttga cgtcatgggg aaggttgcat ggctatgggc ctgttctcct        60
     ctgcataaaa aatggccatt atctgttttt gctattaatg tcatacctgc tattcagaca       120
     aatcaatttg ctctcttaat aaaggatgag cttcctgtag ctttttgtag ctgggccagt       180
     ttagatctgg aatgtgaggt aaaatatata aatgatgtaa catctttgta tgcaaaagac       240
     tggatgtcgg gagaaagaaa gtggtttatt gactggatag ctccatttgg acacaacatg       300
     gagttatata aatacatgag gaaaaagtat ccttatgagt tattcagagc aataaggtta       360
     gatgagagca gtaaaacagg aaaaatagct gaatttcatg gaggggggat agataaaaaa       420
     ctggcatcaa aaatattcag gcaataccat catgaactta tgtctgaagt aaaaaacaga       480
     caagatttta attttaatat tgagaaagaa aactaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page