(data stored in SCRATCH zone)

EMBL: CP001163.PE10

CP001163.PE10        Location/Qualifiers
FT   CDS_pept        10719..10832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34446"
FT                   /protein_id="ACI34446.1"
FT                   /translation="MGIFNGSFVDHSWICLLDRASGYVDKSFQGNSIHNRL"
     atggggatct ttaatggatc ctttgttgat cattcatgga tctgtttact ggatcgagcc        60
     tccggatatg tggataaatc attccaggga aacagcatac acaaccgctt ataa             114
//

If you have problems or comments...

PBIL Back to PBIL home page