(data stored in SCRATCH zone)

EMBL: CP001163.PE105

CP001163.PE105       Location/Qualifiers
FT   CDS_pept        91053..91565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0012"
FT                   /product="EtpM"
FT                   /note="identified by match to protein family HMM PF04612"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34512"
FT                   /protein_id="ACI34512.1"
FT                   /translation="MNELKKRLQYVSPRERRLLIGCVALLVVVFVYYVLWQPWLIREDK
FT                   WRTVVTREKNTVEWMKQQVPNIKRREASMPEQGEPLGLSAAVTRTSAAYGVSVTRLQPQ
FT                   GERLAVTLAPVEFNALMQWLTQLERRHRIRTMVFDVAAQGNPPGQVTVNRLVLSQDDVN
FT                   KDASLSR"
     atgaacgagc ttaaaaaacg tttgcagtat gttagccccc gtgagcgcag gctgcttatc        60
     ggatgtgttg ccttactggt tgttgttttt gtctattacg tcctctggca gccctggctg       120
     atacgagagg ataagtggcg gactgtagtt acccgtgaaa aaaacacagt ggagtggatg       180
     aaacaacagg tacccaacat aaagagacgg gaggcaagta tgcctgaaca gggggagccg       240
     ttaggtttat ctgcggccgt gacacgtact tcagccgcat acggtgtatc ggtcacccgg       300
     ttgcagcctc aaggggagcg tctggccgtc accttagccc cggttgaatt taatgcgctg       360
     atgcagtggc ttacgcaact ggagcgtcgg caccgtattc gtaccatggt atttgatgtg       420
     gccgcgcagg gcaacccacc cggacaggta acggttaatc ggctggtttt gtcccaagat       480
     gacgtaaaca aggacgcttc gcttagtcgc tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page