(data stored in SCRATCH zone)

EMBL: CP001163.PE106

CP001163.PE106       Location/Qualifiers
FT   CDS_pept        91632..92456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0013"
FT                   /product="bacterial Peptidase A24 N-domain protein"
FT                   /note="identified by match to protein family HMM PF01478;
FT                   match to protein family HMM PF06750"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34470"
FT                   /protein_id="ACI34470.1"
FT                   /translation="MPEFAVDYPLLWLICTGGLGGVTGSFLNVVIHRLPIMLERRWRRE
FT                   ALTLLAHSVPESGPAFNLMIPQSHCPCCFHPLGIRDNIPLLSYLFLKGKSRCCGERIPV
FT                   YYPLVEITNSVLFILAASRFPPGLTLAAAWLFISMLLVLAVIDCHTALLPDVLTLPLLW
FT                   LGLLFSLQRGVVTLEEAVVGAVSGYLCLWGLYWLFRFATGREGLGYGDFKLAAALGAWM
FT                   GWQALPSILLFASVSGLIVTVLLRIVTATDFTRPLPFGPWLALSGVCHFLLM"
     ttgccggaat ttgcggttga ttatcccttg ttgtggctca tctgcaccgg agggctgggg        60
     ggcgttaccg gcagttttct taacgtcgtg attcatcgtc tgccgataat gttggagagg       120
     cggtggcggc gtgaagcgct gacgctattg gcacattctg tgcctgagtc cgggccggcc       180
     tttaacctga tgataccgca gtctcattgt ccctgctgtt ttcatccgct cggcatcagg       240
     gataacattc ccctgttaag ctacctattt ctgaagggga aatcacgctg ttgtggcgag       300
     cgtattcccg tttactaccc gctagtcgaa ataacgaact cagtgttatt cattctggcc       360
     gcgagcaggt ttccaccagg gctgacatta gcggctgcct ggctttttat ttccatgctg       420
     ttggttctgg cggttattga ctgccatacg gcgctgctgc cggatgtgct gacgttgcca       480
     ttgctctggc ttggcctgtt attcagttta cagagaggcg ttgtcacctt agaggaggcg       540
     gtagtggggg cggtatctgg gtatctctgt ctgtggggac tgtactggct ttttcgtttc       600
     gctaccggga gggaagggtt aggttacggt gattttaagc tagctgcggc attgggagca       660
     tggatgggtt ggcaggcatt accctcaata cttttgtttg cctcagtcag tgggttaatc       720
     gtaacagtac tgttgcgtat tgtaacagct acggacttta cccgcccgct gccttttggg       780
     ccgtggctcg ctttgagcgg agtgtgccat tttttgttga tgtag                       825
//

If you have problems or comments...

PBIL Back to PBIL home page