(data stored in SCRATCH zone)

EMBL: CP001163.PE107

CP001163.PE107       Location/Qualifiers
FT   CDS_pept        92551..92949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0014"
FT                   /product="EptO"
FT                   /note="identified by match to protein family HMM PF09691;
FT                   match to protein family HMM TIGR01004"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34432"
FT                   /protein_id="ACI34432.1"
FT                   /translation="MGNILKKLNCIASLLVLVTISGCHQSPSIHKQATVPPSEQLEQMA
FT                   SIVSATRYLKMRCNRSDLPDEQSILNVANRIAIGKGWQSLTQEDIRKHSDDIYVRLTRD
FT                   STPEYIKCREFNRRLVPFIGELLARGRG"
     atgggtaata ttttgaaaaa actgaattgt atcgcgtcat tactagtctt agtgactatc        60
     tctggttgtc atcagtcacc ctccatccat aagcaggcca ctgttcctcc gagcgaacaa       120
     ctggaacaaa tggcgtcgat tgtctctgcg acacggtatc tgaaaatgag atgtaaccgt       180
     agtgatttac cagatgaaca gtcgatccta aatgtcgcta accggatcgc tatcgggaaa       240
     gggtggcagt cattaactca ggaggatata cgtaaacaca gcgatgatat ctatgtgcgt       300
     ctgactaggg acagtacgcc tgagtatata aaatgcagag aattcaatcg gcggctggtc       360
     ccatttatcg gtgaattatt ggcaaggggt cgtggataa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page