(data stored in SCRATCH zone)

EMBL: CP001163.PE108

CP001163.PE108       Location/Qualifiers
FT   CDS_pept        93128..93433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0015"
FT                   /product="IS911, transposase orfA"
FT                   /note="identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34477"
FT                   /protein_id="ACI34477.1"
FT                   /translation="MKKRNFSAEFKRESAQLVVDQNYTVADAAKAMDIGLSTMTRWVKQ
FT                   LRDERQGKTPKASPITPEQIEIRELRKKLQRIEMENEILKKATTALLMSDSLNSSR"
     atgaaaaaaa gaaatttcag cgcagagttt aaacgcgaat ccgctcaact ggttgttgac        60
     cagaactaca cggtggcaga tgccgccaaa gctatggata tcggcctttc cacaatgaca       120
     agatgggtca aacaactgcg tgatgagcgt cagggcaaaa caccaaaagc ctctccgata       180
     acaccagaac aaatcgaaat acgtgagctg aggaaaaagc tacaacgcat tgaaatggag       240
     aatgaaatat taaaaaaggc tacaaccgcg ctcttgatgt cagactccct gaacagttct       300
     cgataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page