(data stored in SCRATCH zone)

EMBL: CP001163.PE12

CP001163.PE12        Location/Qualifiers
FT   CDS_pept        complement(11024..11644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34430"
FT                   /protein_id="ACI34430.1"
FT                   /translation="MRQERVLRIKAFRRALELGGGERADGCRHFPRWKTELRNFPHSSC
FT                   DLASNTLAYYLKERERCHPCIIFMEGNAGFHEAENSTVHGHVIVLLDGEYIDLTLDQFD
FT                   EYPDYIPYEPVESDGQIGKLLRNIMKHEDPVKTRQIDLDGGEELYAWLRDTADEVLAAD
FT                   PEWQARERSIEEAREAAITVFPFLSDVQKTECEQGPDSQEAAR"
     atgagacagg aaagagtatt acgtataaag gcatttcgac gggcactgga gcttggtggc        60
     ggtgaacggg ctgacgggtg tcgtcatttt ccccgctgga aaacggaact gaggaatttc       120
     ccgcacagca gctgcgattt agccagcaat actctggcgt actacctcaa agaacgagag       180
     agatgccatc cgtgcatcat ttttatggaa gggaacgctg gctttcatga agcggaaaac       240
     tcaacagttc acgggcatgt catcgtattg ctggacggag agtacatcga tttgacgctg       300
     gatcaattcg acgaatatcc ggactacatt ccttacgaac ctgtcgaatc tgacgggcag       360
     attggtaagc tgttgcgtaa tatcatgaag catgaggacc cggtaaaaac ccgccagatt       420
     gatctcgatg gtggcgaaga gctgtatgcc tggttacgcg ataccgccga cgaagtgctg       480
     gcagcagatc cggaatggca ggcccgggaa cggtcgatag aagaagcaag ggaagccgct       540
     attacggtgt tcccgtttct gtctgacgtg caaaaaactg agtgcgaaca gggcccggac       600
     agtcaggagg ctgccagatg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page