(data stored in SCRATCH zone)

EMBL: CP001163.PE13

CP001163.PE13        Location/Qualifiers
FT   CDS_pept        complement(11641..12099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34424"
FT                   /protein_id="ACI34424.1"
FT                   /translation="MRAFRARQREQATPLPPELAQLLTGQLGLLWQAAVKQAEAGALAA
FT                   REQADDDIARADKERDEALANVAALESELAVLREVVAERDRLLQEVRELRAEALPLREQ
FT                   VARLTATGEHLAAQLQDTKAELKEAREDGRQLQTELLALARQDGKVKK"
     atgcgcgcgt tccgcgcccg ccagcgcgag caggccacgc ccctgccgcc ggagctggcg        60
     cagctgctga ccggccagct ggggctgctg tggcaggcgg ccgtgaaaca ggctgaagcc       120
     ggggccctgg cggcgcgcga gcaggccgac gacgacattg cccgggccga caaggagcgg       180
     gatgaggcgc tggcgaacgt ggccgcgctg gaaagcgagc tggcggtgct gcgcgaggtg       240
     gtggccgaac gtgaccgcct gctgcaggag gtacgcgagc tacgcgcgga ggcgctgccg       300
     ctgcgcgagc aggtggcccg cctgaccgcc accggcgaac acctggcggc gcagctgcag       360
     gacacgaagg cggagctgaa ggaagcccgg gaggacggcc gccagcttca gaccgaactg       420
     ctggctctgg cccgccagga cgggaaggtg aagaaatga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page