(data stored in SCRATCH zone)

EMBL: CP001163.PE16

CP001163.PE16        Location/Qualifiers
FT   CDS_pept        complement(13055..13942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0035"
FT                   /product="IS629, transposase orfB"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34490"
FT                   /protein_id="ACI34490.1"
FT                   /translation="MPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   RDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTVSRKAVSAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFSGCIVGWR
FT                   VSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTERLKEAKLLASTGSTGD
FT                   SYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHIPPAEAE
FT                   KAYYASIRNDDLAA"
     atgccgctgc tggataagct gcgtgagcag tacggggtcg gaccggtatg cagtgaactg        60
     catattgccc cgtcaacgta ttaccactgt cagcaacagc gacatcatcc ggataaacgc       120
     agtgcccgtg cgcagcgcga tgactggctg aagagagaga tacagcgcgt atacgatgaa       180
     aatcatcagg tgtacggtgt gcgtaaagtc tggcgccagt tgttacgcga aggtatcagg       240
     gtggccagat gtacagtggc gcgcctcatg gcggttatgg gacttgccgg tgttctccgg       300
     ggtaaaaagg tccgtactac cgtcagccgg aaagccgttt ccgcaggcga ccgcgtaaac       360
     cgtcagttcg tggcagaacg tcctgaccag ctgtgggtgg ctgattttac ttacgtcagc       420
     acatggcagg gcttcgtcta tgtggcgttc atcattgatg tgttttccgg atgtatcgtg       480
     gggtggcgag tctcatcgtc tatggaaacg acattcgtgc tggatgcact ggagcaggcg       540
     ttgtgggccc gtcggccgtc cggcacagtc catcacagtg ataaaggttc tcagtatgta       600
     tcactggcct atacggagcg actaaaagaa gcaaaactgc tggcatcaac agggagtaca       660
     ggtgactcgt atgacaacgc gatggcggag agcatcaatg gtctttacaa agcggaggta       720
     atacaccgta agagctggaa aaaccgtgca gaagtggaac tggccacact cacgtgggtg       780
     gactggtata acaatcgacg attgctggga aggctgggtc atatccctcc ggcagaagca       840
     gaaaaagctt attatgcttc catcagaaac gatgatctgg cagcctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page