(data stored in SCRATCH zone)

EMBL: CP001163.PE17

CP001163.PE17        Location/Qualifiers
FT   CDS_pept        complement(13942..14268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0036"
FT                   /product="IS629, transposase orfA"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34472"
FT                   /protein_id="ACI34472.1"
FT                   /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
     atgactaaaa atacacgttt ttcccccgag gtccgtcaac gggcagtccg tatggttctg        60
     gaaagtcagg gcgaatatga ctcacaatgg gcggcaattt gttccattgc cccaaagatt       120
     ggctgtacac cagagactct gcgtgtgtgg gttcgtcagc atgagcggga taccgggggc       180
     ggtgatggtg gactcaccac cgctgaacgt cagcgtctga aagagctgga acgtgaaaat       240
     cgtgaactgc gccgcagtaa cgatatcctt cgccaggctt ccgcttattt tgcgaaggcg       300
     gagttcgacc gcctctggaa aaaataa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page