(data stored in SCRATCH zone)

EMBL: CP001163.PE18

CP001163.PE18        Location/Qualifiers
FT   CDS_pept        14367..14621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0037"
FT                   /product="cytotoxic protein CcdB"
FT                   /note="identified by match to protein family HMM PF01845"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34440"
FT                   /protein_id="ACI34440.1"
FT                   /translation="MDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWR
FT                   MMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     gtggatgtac agagtgatat tattgacacg cccgggcgac ggatggtgat ccccctggcc        60
     agtgcacgtc tgctgtcaga taaagtctcc cgtgaacttt acccggtggt gcatatcggg       120
     gatgaaagct ggcgcatgat gaccaccgat atggccagtg tgccggtctc cgttatcggg       180
     gaagaagtgg ctgatctcag ccaccgcgaa aatgacatca aaaacgccat taacctgatg       240
     ttctggggaa tataa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page