(data stored in SCRATCH zone)

EMBL: CP001163.PE19

CP001163.PE19        Location/Qualifiers
FT   CDS_pept        14622..15428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0038"
FT                   /product="resolvase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34500"
FT                   /protein_id="ACI34500.1"
FT                   /translation="MSGSVIHSQSAVMVPAVYSAGQPASLPVAIDYPAALALRQMSMVH
FT                   DELPKYLLAPEVSALLHYVPNLHRKMLLATLWNTGARINEALALTRGDFSLAPPYPFVQ
FT                   LATLKQRTEKAARTAGRMPAGQQTHRLVPLSDSWYVSQLQTMVATLKIPMERRNRRTGR
FT                   TEKARIWEVTDRTVRTWIGEAVAAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVL
FT                   QSLMGHKSISSKEVYTKVFALDVAARHRVQFAMPESDAVAMLKQLS"
     atgtcaggct ccgttataca cagccagtct gcagtcatgg taccggcagt gtattctgcc        60
     ggacagcctg catcgctgcc tgttgccatt gattatccgg cagctctggc acttcgccag       120
     atgtcgatgg tccatgatga actgccaaaa tatctgctgg ctccggaagt gagtgccctg       180
     ctccattacg tcccgaatct gcaccgcaag atgctgctgg ccacactgtg gaacaccgga       240
     gcacgcatta atgaagcact ggcgctgacg cggggggatt tttcgcttgc gcctccgtat       300
     ccgtttgtgc agcttgcgac cctgaaacaa cggaccgaaa aagctgccag gacggcgggg       360
     agaatgcccg ccggtcagca gactcaccgg ctggttccgc tctctgactc ctggtacgtc       420
     agccagctgc agacgatggt ggcaacactg aaaataccca tggagcggcg taaccgtcgc       480
     acaggaagga cagagaaagc gcggatctgg gaagtgacgg acagaacggt caggacctgg       540
     attggggagg cggttgccgc cgctgctgct gacggtgtga cgttctctgt tccggtcaca       600
     ccacatacgt tccgccattc ctatgcgatg cacatgctgt atgctggtat accgctgaaa       660
     gttctgcaaa gcctgatggg acataagtcc atcagttcaa aggaagtcta cacgaaggtt       720
     tttgcgctgg atgtggctgc ccggcaccgg gtgcagtttg cgatgccgga gtctgatgcg       780
     gttgcgatgc tgaaacaatt atcctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page