(data stored in SCRATCH zone)

EMBL: CP001163.PE2

CP001163.PE2         Location/Qualifiers
FT   CDS_pept        713..3709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0018"
FT                   /product="RTX C-domain protein"
FT                   /note="identified by match to protein family HMM PF00353;
FT                   match to protein family HMM PF02382; match to protein
FT                   family HMM PF08339"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34487"
FT                   /protein_id="ACI34487.1"
FT                   /translation="MTVNKIKNIFNNATLTTKSAFNTASSSVRSAGKKLILLIPDNYEA
FT                   QGVGINELVKAADELGIEIHRTERDDTAIANQFFGAAEKVVGLTERGVAIFAPQLDKLL
FT                   QKYQKVGSKIGGTAENVGNNLGKAGTVLSALQNFTGIALSGMALDELLRKQRAGEDISQ
FT                   NDIAKSSIELINQLVDTVSSINSTVDSFSEQLNQLGSFLSSKPRLSSVGGKLQNLPDLG
FT                   PLGDGLDVVSGILSAVSASFILGNSDAHTGTKAAAGIELTTQVLGNVGKAVSQYILAQR
FT                   MAQGLSTTAASAGLITSAVMLAISPLSFLAAADKFERAKQLESYSERFKKLNYEGDALL
FT                   AAFHKETGAIDAALTTINTVLSSVSAGVSAASSASLIGAPISMLVSALTGTISGILEAS
FT                   KQAMFEHVAEKFAARINEWEKEHGKNYFENGYDARHAAFLEDSLSLLADFSRQHAVERA
FT                   VAITQQHWDEKIGELAGITRNADRSQSGKAYINYLENGGLLEAQPKEFTQQVFDPQKGT
FT                   IDLSTGNVSSVLTFITPTFTPGEEVRERKQSGKYEYMTSLIVNGKDTWSVKGIKNHKGV
FT                   YDYSKLIQFVEKNNKHYQARIISELGDKDDVVYSGAGSSEVFAGEGYDTVSYNKTDVGK
FT                   LTIDATGASKPGEYIVSKNMYGDVKVLQEVVKEQEVSVGKRTEKIQYRDFEFRTGGIPY
FT                   DVIDNLHSVEELIGGKHDDEFKGGKFNDIFHGADGNDYIEGNYGNDRLYGDDGDDYISG
FT                   GQGDDQLFGGSGNDKLSGGDGNNYLTGGSGNDELQAHGAYNILSGGTGDDKLYGGGGID
FT                   LLDGGEGNDYLNGGFGNDIYVYGQNYGHHTIADEGGKGDRLHLSDISFDDIAFKRVGND
FT                   LIMNKAINGVLSFNESNDVNGITFKNWFAKDASGADNHLVEVITDKDGREIKVDKIPHN
FT                   NNERSGYIKASNIASEKNMVNITSVANDINKIISSVSGFDSGDERLASLYNLSLHQNNT
FT                   HSTTLTTTV"
     atgacagtaa ataaaataaa gaacattttc aataatgcga cattgactac aaaatcagca        60
     tttaatacag catcatcaag cgtacgttcc gctggaaaaa aactcatatt attaatacct       120
     gataattatg aagctcaggg cgtgggtatt aatgagttgg tcaaagctgc tgatgagctt       180
     ggaatagaaa tacaccgtac tgaacgagat gatacagcga ttgcaaacca gttttttggt       240
     gcagcagaaa aagttgtagg attaactgaa cgtggtgttg caatattcgc accacaactt       300
     gacaaacttc tgcagaagta tcagaaagtt gggagtaaaa taggaggaac cgctgaaaat       360
     gtaggtaata atctgggaaa agccggaaca gttctctcag cactacagaa ttttacgggg       420
     attgctttat caggcatggc tcttgatgaa ttgctgagaa aacaacgggc aggagaggat       480
     ataagtcaga atgatattgc caaaagtagt attgaactta ttaatcagct tgtagataca       540
     gtatcaagta taaacagtac cgttgattca ttttctgagc agcttaacca gcttggctca       600
     tttttatcca gtaaacctcg attaagttct gttggtggga aattacaaaa tttaccagac       660
     ctgggccccc tgggggatgg gctggatgtt gtctccggaa ttctttctgc tgtatcagca       720
     agctttattc tgggaaacag tgacgcacat acaggaacaa aagctgcagc gggtatcgaa       780
     ctgacaactc aggttcttgg aaatgttggt aaagctgttt cgcaatatat tctggctcag       840
     agaatggcac aggggttatc gacaacagct gcaagtgcgg gtctgatcac atcggctgtt       900
     atgctggcta tcagtcctct ttctttcctg gctgctgcag ataaatttga gcgagctaag       960
     cagcttgaat catattctga acgatttaaa aaattgaatt atgaagggga tgctttactc      1020
     gcagcctttc ataaagaaac cggagctata gatgcagccc tgacaacaat aaatactgtc      1080
     ctgagttctg tatctgcggg agttagtgca gcctccagtg catccctcat aggggccccg      1140
     ataagcatgc tggtgagtgc attaaccggt acgatatctg gcattctgga agcatcaaaa      1200
     caggctatgt ttgagcacgt tgcagagaaa ttcgctgctc ggatcaatga atgggaaaag      1260
     gagcatggca aaaattattt tgagaatgga tatgacgcaa gacatgctgc gtttttagaa      1320
     gactctctgt ctttgcttgc tgatttttct cgtcagcatg cagtagaaag agcagtcgca      1380
     ataacccagc aacattggga tgagaagatc ggtgaacttg caggcataac ccgtaatgct      1440
     gatcgcagtc agagtggtaa ggcatatatt aattatctgg aaaatggagg gcttttagag      1500
     gctcaaccga aggagtttac acaacaagtg tttgatcctc aaaaagggac catagacctt      1560
     tcaacaggta atgtatcaag tgttttgaca tttataacac caacatttac cccaggagaa      1620
     gaagttagag aaagaaaaca gagtggtaaa tatgaatata tgacatctct tattgtaaat      1680
     ggtaaggata catggtctgt aaaaggcata aaaaatcata aaggtgtata tgattattca      1740
     aaattgattc agtttgttga aaagaataac aaacactatc aggcgagaat aatttctgag      1800
     ctcggagata aagacgatgt ggtttattct ggagcaggct catcagaagt atttgctggt      1860
     gaaggttatg ataccgtatc ttataataag acggatgttg gtaaactaac aattgatgca      1920
     acaggagcat caaaacctgg tgagtatata gtttcaaaaa atatgtatgg tgacgtgaag      1980
     gtattgcagg aagtcgttaa ggaacaggag gtgtcagtag ggaagcgaac agagaaaata      2040
     caatatcgtg attttgaatt cagaaccggt ggaattcctt atgatgtaat agataatctt      2100
     cattctgttg aagagctcat tggcggaaaa catgatgatg aattcaaagg cggtaagttt      2160
     aatgatatat tccatggcgc agatgggaac gattatatcg aaggtaatta tggtaatgat      2220
     cgactatacg gcgatgatgg ggatgattat atatccggag gacagggaga cgaccagtta      2280
     tttggtggta gtggaaacga taaattgagt ggaggggatg gtaataatta tctgacagga      2340
     ggaagcggta atgatgagct tcaggcacac ggagcttata atattctgtc aggtggtact      2400
     ggtgatgata aactttatgg tggtggtggt attgatcttc tggatggagg ggaaggtaat      2460
     gactatctga atggtggttt tggtaatgat atttatgttt atgggcaaaa ctatggtcat      2520
     catacaattg cagatgaagg aggtaaagga gatcgtttgc acttatctga tattagcttt      2580
     gatgatatcg catttaagag agttggaaat gatcttatca tgaataaagc cattaatggt      2640
     gtactttcat ttaatgagtc aaatgatgtc aatgggataa catttaaaaa ctggtttgcg      2700
     aaagatgcct caggagcaga taatcatctt gttgaggtta taacagataa agatggtcga      2760
     gagataaaag ttgataagat acctcataat aataatgaac ggtcaggtta tataaaagcc      2820
     agtaatatag catctgaaaa aaacatggtt aatatcacca gtgttgccaa tgatattaat      2880
     aagattattt cttcagtttc agggttcgat tcaggtgatg aacgattagc atctttatat      2940
     aatttatcct tacatcaaaa caacacacac tcaacaactt taacgacaac tgtctga         2997
//

If you have problems or comments...

PBIL Back to PBIL home page