(data stored in SCRATCH zone)

EMBL: CP001163.PE22

CP001163.PE22        Location/Qualifiers
FT   CDS_pept        complement(16151..17038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0041"
FT                   /product="IS629, transposase orfB"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF00665"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34480"
FT                   /protein_id="ACI34480.1"
FT                   /translation="MPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARAQ
FT                   HDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGKKV
FT                   RTTISRKAVAAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYIVGGR
FT                   VSSSMETTFVLDALEQALWARRPSGTIHHSDKGSQYVSLAYTERLKEAGLLASTGSTGD
FT                   SYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHTPPAEAE
FT                   KAYYASIGNDDLAA"
     atgccactgc tggataagct gcgtgagcag tacggggtcg gaccggtatg cagcgaactg        60
     catattgccc cgtcaacgta ttaccattgt cagcaacagc gacatcatcc ggataaacgc       120
     agtgcccgtg cgcagcacga cgactggctg aagagagaga tacagcgcgt atacgatgaa       180
     aatcatcagg tgtacggtgt gcgtaaagtc tggcgtcagt tgttacggga aggaatcagg       240
     gtggccagat gtacagtggc acgtctcatg gcggttatgg gacttgccgg tgttctccgg       300
     ggtaaaaagg tccgtacgac catcagccgg aaagccgttg ccgcaggcga ccgcgtaaac       360
     cgtcagttcg tggcagaacg acctgaccag ctgtgggtgg ctgattttac ttacgtcagc       420
     acatggcagg gcttcgtcta tgtggcgttt atcattgatg tgtttgccgg atacatcgtg       480
     ggggggcggg tctcatcgtc tatggaaacg acattcgtgc tggatgcgct ggagcaggcg       540
     ttgtgggccc gtcgtccgtc tggcaccatc catcacagcg ataaaggctc tcagtatgtg       600
     tcactggcct atacggagcg actaaaagaa gccggattac tggcatcaac agggagtaca       660
     ggcgactcgt atgacaacgc gatggctgag agcatcaatg gtctttacaa agcggaggta       720
     atacaccgta agagctggaa aaaccgtgca gaagtggaac tggccacact aacgtgggtg       780
     gactggtata acaatcgacg attgctggga aggctgggcc atactcctcc ggcagaagca       840
     gaaaaagctt attatgcttc catcggaaac gatgatctgg cagcctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page