(data stored in SCRATCH zone)

EMBL: CP001163.PE23

CP001163.PE23        Location/Qualifiers
FT   CDS_pept        complement(17038..17364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0042"
FT                   /product="IS629, transposase orfA"
FT                   /note="overlaps another CDS with the same product name;
FT                   identified by match to protein family HMM PF01527"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34513"
FT                   /protein_id="ACI34513.1"
FT                   /translation="MTKNTRFSPEVRQRAIRMVLESQDEYDSQWAAICSIAPKIGCTPE
FT                   TLRVWVRQHERDTGGGDGGLTSAERQRLKELERENRELRRSNDILRQASAYFAKAEFDR
FT                   LWKK"
     atgactaaaa atactcgttt ttcccccgaa gtccgtcagc gggcgattcg tatggttctg        60
     gaaagtcagg atgaatatga ctcacagtgg gcggcaattt gttccattgc cccaaagatt       120
     ggctgtacgc cggagactct gcgtgtctgg gttcgccagc atgagcggga taccgggggc       180
     ggtgatggtg ggctcaccag cgctgaacgt cagcgtctga aagagctgga acgtgaaaat       240
     cgtgaactgc gccgcagtaa cgatatcctt cgccaggctt ccgcttattt tgcgaaggcg       300
     gagttcgacc gcctctggaa aaaatga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page