(data stored in SCRATCH zone)

EMBL: CP001163.PE27

CP001163.PE27        Location/Qualifiers
FT   CDS_pept        21615..22517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06924"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34423"
FT                   /protein_id="ACI34423.1"
FT                   /translation="MYFSGEPAQIAEIKRLASGAVTPLYRRATNEGIQLFLAGSAGLLQ
FT                   TTEDVRFEPCPGLTAAGRGVVSPENIAFTRWLTHLQDGVLLDEQNCLMLHELWLQSGTG
FT                   RRRWEELPDDARESITALFTPKRGDWCDIWSNEDVSVWWNRLCDNVLPEKTMPFDLLTV
FT                   LSTRLDVEVNGFNGGVLNGVPSAYHWYTEQYGVKWPCGYEVNISSQGDNFIQVDFDTPW
FT                   CQPESDVIAVLSRRFSCMLEHWYAGQGCNFCGWQRYERGELVDVLWGELEWSSPTDDDE
FT                   LPEVTAPEWIVDKVAHYGG"
     atgtattttt ctggtgaacc ggcacagatc gctgagatta aacgactggc cagcggtgca        60
     gtcacaccgc tttatcgccg cgccacaaat gaaggtattc agctgtttct ggccggaagt       120
     gccggacttc tgcagaccac tgaagatgtg cggtttgaac catgccccgg actgacggct       180
     gccgggcgtg gcgttgtatc gccggagaat atcgcgttca cccgctggct gacacacctg       240
     caggacggtg tacttctgga tgagcaaaac tgcctgatgc tgcatgaact ctggctgcag       300
     agcggtactg gccggcgtcg ctgggaagaa ttaccggatg atgccaggga aagcattacc       360
     gctcttttca ccccaaaaag aggtgactgg tgcgacatct ggagtaacga ggatgtatct       420
     gtgtggtgga accgtctgtg tgacaacgtc ctgccggaaa aaaccatgcc gtttgacctg       480
     ctgacggttc tgtccactcg cctggatgtt gaagtgaatg gctttaacgg tggtgttctg       540
     aacggtgttc cttctgcata tcactggtat acggaacagt atggcgtgaa gtggccttgt       600
     gggtatgagg tgaatatcag cagtcaggga gacaacttca ttcaggttga tttcgacacg       660
     ccgtggtgtc agccggaaag cgacgttatt gcagtattaa gccgccgttt cagttgcatg       720
     ctggagcact ggtacgccgg gcagggctgc aatttctgtg gctggcagcg atatgagcgt       780
     ggagagcttg ttgatgtgct gtggggggaa ctggaatggt cttccccgac agatgatgat       840
     gagctgccgg aagtcaccgc gccggagtgg atagtcgaca aggtggcgca ttacggtgga       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page