(data stored in SCRATCH zone)

EMBL: CP001163.PE28

CP001163.PE28        Location/Qualifiers
FT   CDS_pept        complement(22468..22689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34429"
FT                   /protein_id="ACI34429.1"
FT                   /translation="MPAGSGKSARPVPGRTRDTDHRQRSCRAASAGAVKRGARRHPLPE
FT                   KKRAVARPSPSYFIHRNAPPCRLSTPAR"
     atgccagccg ggagcggtaa aagcgcccgt cccgtgcccg gccggacgcg ggacactgac        60
     cacaggcagc gttcctgccg cgccgcgtca gccggcgcag taaaaagagg agcccggcga       120
     catcctttac cggaaaagaa acgggcggtt gcccgcccgt ctccgtcata cttcatccac       180
     cgtaatgcgc caccttgtcg actatccact ccggcgcggt ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page