(data stored in SCRATCH zone)

EMBL: CP001163.PE29

CP001163.PE29        Location/Qualifiers
FT   CDS_pept        complement(22670..22795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34428"
FT                   /protein_id="ACI34428.1"
FT                   /translation="MEYRSRRLFDGENMPRKRLEGRSSEKGDGLAYTVTDASRER"
     gtggaatatc gcagccgtcg tctttttgac ggcgagaata tgccgcgaaa gcggcttgaa        60
     gggcgttcat cagaaaaggg cgacgggctg gcgtacactg tcaccgatgc cagccgggag       120
     cggtaa                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page