(data stored in SCRATCH zone)

EMBL: CP001163.PE3

CP001163.PE3         Location/Qualifiers
FT   CDS_pept        3759..5879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0019"
FT                   /product="type I secretion system ATPase family protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412; match to protein family HMM TIGR01846"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34454"
FT                   /protein_id="ACI34454.1"
FT                   /translation="MMSKCSSHNSLYALILLAQYHNITVNAETIRHQYNTHTQDFGVTE
FT                   WLLAAKSIGLKAKYVEKHFSRLSIISLPALIWRDDGKHYILSRITKDSSRYLVYDPEQH
FT                   QSLTFSRDEFEKLYQGKVILVTSRATVVGELAKFDFSWFIPSVVKYRRILLEVLTVSAF
FT                   IQFLALITPLFFQVVMDKVLVHRGFSTLNIITIAFIIVILFEVILTGARTYIFSHTTSR
FT                   IDVELGAKLFRHLLALPVSYFENRRVGETVARVRELEQIRNFLTGQALTSVLDLFFSVI
FT                   FFCVMWYYSPQLTLVILLSLPCYVIWSLFISPLLRRRLDDKFLRNAENQAFLVETVTAI
FT                   NTIKSMAVSPQMIATWDKQLAGYVASSFRVNLVAMTGQQGIQLIQKSVMVISLWMGAHL
FT                   VISGEISIGQLIAFNMLAGQVIAPVIRLAHLWQDFQQVGISVERLGDVLNTPVEKKSGR
FT                   NILPEIQGDIEFKNVRFRYSSDGNVILNNINLYISKGDVIGIVGRSGSGKSTLTKLLQR
FT                   FYIPETGQILIDGHDLSLADPEWLRRQIGVVLQENILLNRSIIDNITLASPAVSMEQAI
FT                   EAARLAGAHDFIRELKEGYNTIVGEQGVGLSGGQRQRIAIARALVTNPRILIFDEATSA
FT                   LDYESENIIMKNMSRICKNRTVIIIAHRLSTVKNANRIIVMDNGFISEDGTHKELISKK
FT                   DSLYAYLYQLQA"
     atgatgagta aatgtagttc tcataatagt ctgtatgcac tgatattgct tgcacaatat        60
     cataatataa ctgtcaatgc tgaaactata aggcatcagt ataataccca cacacaagat       120
     tttggggtga ctgaatggtt actggcagcg aaatctattg gcttaaaagc aaaatatgta       180
     gaaaaacatt tttccagatt gtcaataatt tctttacctg cgttgatatg gcgggatgac       240
     ggtaagcatt atatattgtc tcgtattact aaagattcat cacgctatct tgtttatgat       300
     ccagaacaac atcagtcact aacttttagt cgggatgagt ttgaaaaact gtatcaggga       360
     aaagtcattc tggttacgtc aagagcaaca gtagtcggag agttagctaa atttgatttt       420
     tcttggttta tcccctctgt tgtgaaatac aggaggattt tacttgaggt gttaactgtt       480
     tctgctttta ttcagtttct tgcgttaata acacctcttt tttttcaggt tgtaatggat       540
     aaggttttag ttcaccgggg gttttcaacg ttaaatatta tcacaatagc atttattata       600
     gtgatacttt ttgaagtgat attaaccgga gccagaactt atattttctc tcatactaca       660
     agtcgtattg acgtcgaact gggtgctaag ttattcagac atttgcttgc attgcctgtt       720
     tcatattttg aaaatcgcag ggtcggagag accgttgcca gagtaaggga actggagcaa       780
     attcgtaatt ttttaaccgg acaagcgttg acatcagttc ttgatctatt tttttctgta       840
     atattttttt gtgtcatgtg gtattacagc cctcaattaa cactggttat attattgtca       900
     ctaccttgtt atgttatatg gtcattgttt atatcaccct tattacgtcg acgtcttgat       960
     gataagtttc tcaggaatgc agaaaatcaa gcttttcttg tcgaaacggt aacagcaata      1020
     aatacaatca aatccatggc agtatcacca cagatgattg ctacatggga taaacaactg      1080
     gccgggtatg ttgcttccag tttcagggta aatctggttg caatgacagg gcagcagggg      1140
     atacagctga tacagaaaag tgtaatggta attagtctat ggatgggagc acatcttgtc      1200
     atatcgggag agataagcat cgggcagtta atcgcgttta atatgcttgc aggtcaggtc      1260
     attgctcctg ttatcagact ggctcatctt tggcaggatt ttcagcaggt tggtatttct      1320
     gttgagcgcc ttggtgatgt attaaataca ccggtagaga aaaagtcagg cagaaatata      1380
     ctgccggaaa ttcaggggga tatcgaattt aaaaatgtca gatttcggta ttcttctgac      1440
     ggtaatgtta ttttgaataa tattaattta tacatatcaa agggggatgt tatcggtata      1500
     gttggccgtt ctggttcagg aaaaagtaca ttaacaaaac tgcttcagcg cttttatata      1560
     ccagagaccg gacagatttt aattgatggg catgatttat cacttgcaga tccagaatgg      1620
     ttacgacgcc agattggtgt tgtattgcag gaaaatatac tattaaatcg tagtattatc      1680
     gataatatta cattagcttc tccggctgta tctatggaac aggctattga ggcagccaga      1740
     cttgcaggtg cccatgattt tattagagaa ctaaaagaag ggtacaatac tattgttgga      1800
     gaacagggcg ttggtctttc aggagggcag cgccaacgga tcgcaatagc ccgggctctt      1860
     gttacaaatc ctcgaattct tatttttgat gaagcaacca gtgctcttga ttatgagtcg      1920
     gaaaatataa taatgaaaaa tatgtcaaga atatgtaaga acagaaccgt aattattatt      1980
     gcacacaggt tgtcaactgt aaaaaatgca aacagaataa ttgttatgga taatggcttt      2040
     atttctgaag atggcacaca taaagagctt atctccaaaa aagacagttt atatgcatat      2100
     ttatatcagt tgcaggcata a                                                2121
//

If you have problems or comments...

PBIL Back to PBIL home page