(data stored in SCRATCH zone)

EMBL: CP001163.PE30

CP001163.PE30        Location/Qualifiers
FT   CDS_pept        22903..23586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0050"
FT                   /product="DNA methylase family protein"
FT                   /note="identified by match to protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34453"
FT                   /protein_id="ACI34453.1"
FT                   /translation="MSRFIQGDCVRVMATIPGNGVDFILTDPPYLVGFRDRQGRTIAGD
FT                   KTDEWLQPACNEMYRVLKKDALMVSFYGWNRVDRFMAAWKNAGFSVVGHLVFTKTYTSK
FT                   AAYVGYRHECAYILAKGRPALPQKPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESFTHP
FT                   NAIVLDPFAGSGSTCVAALQSGRRYIGIELLEQYHRAGQQRLAAVQRAMQQGAANDDWF
FT                   MPEAA"
     atgtcccgtt ttatccaggg tgactgcgtg cgtgttatgg ccacgattcc gggcaatggt        60
     gtcgatttca tcctcaccga cccgccatat ctcgtcggtt tccgtgaccg tcaggggcgt       120
     accatcgccg gcgataaaac cgatgaatgg ctgcaaccgg cctgtaatga aatgtaccgc       180
     gtgctgaaaa aagatgcgct gatggtgagc ttctatggct ggaaccgcgt cgatcgcttt       240
     atggccgcct ggaaaaatgc gggattcagc gtggttggcc acctggtttt taccaaaacc       300
     tacacttcga aggccgcata tgtgggctat cgccacgaat gcgcttacat cctggcaaaa       360
     gggcgtccgg cgctgcctca gaagccattg cccgacgtgc tgggctggaa atattcaggc       420
     aatcgtcatc acccgacgga aaagcctgtt accagcctgc aaccactgat tgagagcttc       480
     acacacccga acgcgattgt gctggacccg tttgcaggca gcggctcaac ctgtgtggcc       540
     gcccttcagt ccggacgccg gtatatcggt atcgagctgc ttgaacagta tcaccgtgcc       600
     ggacagcaac gtctggctgc cgtacagcgg gccatgcagc agggggccgc aaatgatgac       660
     tggtttatgc cggaggctgc gtaa                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page