(data stored in SCRATCH zone)

EMBL: CP001163.PE31

CP001163.PE31        Location/Qualifiers
FT   CDS_pept        23587..23808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34514"
FT                   /protein_id="ACI34514.1"
FT                   /translation="MNYAGHEKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVERL
FT                   ARQTLYRANRLFMEAYTEILELDACFKD"
     atgaactatg ccggacatga aaaacttcgc gccgacgtgg cggaggtggc caacaccatg        60
     tgtgaccttc gggccaggct gaacgatatg gagcatcgct gtcgctttga ttccgatgtg       120
     cttgttgaac gcctggcacg ccagacgctg tatcgcgcca atcgcctgtt catggaggcg       180
     tataccgaaa ttctggaact ggatgcgtgc tttaaagatt ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page