(data stored in SCRATCH zone)

EMBL: CP001163.PE32

CP001163.PE32        Location/Qualifiers
FT   CDS_pept        23822..24256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07128"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34443"
FT                   /protein_id="ACI34443.1"
FT                   /translation="MYGTCETLCRELAAKYPGYTPLMLVIWSPEEIQALADGMDISLSD
FT                   PEIRTVLARLEDIPEDQRIESGISSAAAMEIISNVSENRQVTVPAELLASLIQTAEQAL
FT                   WKREWAARDYGLAVPECVTRRQAVVNQARILLKNNTHENG"
     atgtacggaa catgcgaaac gctatgccgg gagctggcag caaagtatcc gggatataca        60
     ccgctgatgc tggttatctg gtccccggaa gagattcagg ccctcgctga cggaatggat       120
     atttccctgt ccgatcctga aatcaggacc gtcctggcgc gcctggagga catcccggaa       180
     gaccagcgaa ttgagtccgg tatttcttct gccgcggcga tggagattat cagcaacgtg       240
     agcgaaaacc gccaggtgac cgtcccggct gaactgctgg cgtccctgat tcagaccgcc       300
     gaacaggcac tgtggaaacg tgaatgggcc gcccgtgatt acggtctcgc cgtcccggaa       360
     tgcgttaccc gccgtcaggc ggtggttaat caggcccgca tcctgctgaa aaacaacaca       420
     cacgaaaacg gctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page