(data stored in SCRATCH zone)

EMBL: CP001163.PE33

CP001163.PE33        Location/Qualifiers
FT   CDS_pept        24302..25078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0053"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34525"
FT                   /protein_id="ACI34525.1"
FT                   /translation="MNENTTLNALICRHARNLLLAQGWPEETDVDQRNPKYPGWISIYV
FT                   LLDAPRLATLLVNRHGGVLPPHLASAIQKLTGTGAELVLSGSQWQSLPVLPADGTQVSF
FT                   PYAGEWLTEDEIRAVLAAVRDAVRSVSCRVAEDTRRIRAALTTTGQTLLTRQTRRFRLV
FT                   VKESDHPCWLDEDDENLPVVLDAILNRGARFSAVEMYLVSDCIEHILSSGLACDVLRIP
FT                   DEPPRRWFDRGVLREVVREARNEIRSMADALAKIRK"
     atgaacgaaa acacaacgct gaacgcactg atttgtcgtc acgcccgtaa cctgctgctg        60
     gcgcagggct ggccggaaga gacggatgtc gaccagcgta acccgaagta tccgggctgg       120
     atcagcattt atgttctgct ggatgcgccc cggctggcga cgttactcgt taaccgccac       180
     ggcggcgtac tgccgccgca cctggcctcc gccattcaga aactgaccgg aaccggagcg       240
     gaacttgttc tgtccggcag tcagtggcag tcgctgccgg tgcttccggc agacggaacg       300
     caggtgtctt ttccgtatgc cggtgaatgg ctgaccgaag acgaaatcag ggctgtactt       360
     gcggcggtgc gcgatgcggt acgcagtgtc agttgccggg tggcagaaga tacgcggcgt       420
     atccgggcgg cgctgaccac caccggtcag acgttactga cccgccagac gcgccgcttt       480
     cgcctggtcg tgaaggaaag cgatcacccc tgctggctcg atgaggacga cgaaaacctg       540
     cccgtggtgc tcgatgccat cctgaaccgg ggcgcacgtt tttcggcggt ggaaatgtat       600
     ctggtcagcg attgtattga acatatcctg tccagtgggc tggcctgcga tgtgctgcgt       660
     ataccggatg aaccgccccg ccggtggttt gaccgtggtg ttctgcggga ggtggtccgg       720
     gaagcccgga acgaaatccg cagcatggcg gatgccctgg caaaaatccg gaaatga          777
//

If you have problems or comments...

PBIL Back to PBIL home page