(data stored in SCRATCH zone)

EMBL: CP001163.PE34

CP001163.PE34        Location/Qualifiers
FT   CDS_pept        complement(25208..25501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0054"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34431"
FT                   /protein_id="ACI34431.1"
FT                   /translation="MHDVFLRCSHIPRHRAVPCLQKSRAIRRGCTGRKGSRSLTHTADG
FT                   SCRVRPRNLSGRTTGKSRQTGRRDRVTAAAKRTLASTPARLRWRHGTARTRR"
     ttgcatgatg ttttcctccg ttgttcacat attccgcgac accgggcggt gccgtgcctc        60
     cagaaaagcc gggcgataag gcggggatgc acagggcgca agggaagccg cagcctgacg       120
     cacacggctg acgggagttg cagggtgagg ccgcgaaacc tgagcgggcg aacgaccgga       180
     aaatcacggc agacgggaag gagggaccgg gtgaccgcag cggcgaagcg tacccttgca       240
     tcaacgccag cccggctaag atggaggcac ggcaccgccc gcacacgacg ctga             294
//

If you have problems or comments...

PBIL Back to PBIL home page