(data stored in SCRATCH zone)

EMBL: CP001163.PE35

CP001163.PE35        Location/Qualifiers
FT   CDS_pept        25496..25921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0055"
FT                   /product="antirestriction protein"
FT                   /note="identified by match to protein family HMM PF03230"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34515"
FT                   /protein_id="ACI34515.1"
FT                   /translation="MQYAKPVTLNVEECDRLSFLPYLFGNDFLYAEAYVYALAQKMMPE
FT                   YQGGFWHFIRLPDGGGYMMPDGDRFHMVNGANWFDRTVSADACGIILTSLVINRQLWLY
FT                   HDSGDAGLTQLYRMRDAQLWRHIEFHPECNAIYAALD"
     atgcaatatg cgaaacctgt cactctgaat gttgaagagt gcgaccgtct ctcctttctg        60
     ccttacctgt ttggcaacga ttttctgtat gccgaggcgt atgtgtacgc gctggcgcaa       120
     aaaatgatgc cggaatatca gggaggcttc tggcacttca tccgcctgcc ggacggtggc       180
     ggttacatga tgccggatgg cgaccgtttc cacatggtga acggtgcaaa ctggtttgac       240
     cgtaccgtga gtgctgatgc ctgcggcatc attctgactt cccttgtgat taaccgccag       300
     ttgtggctgt accacgacag cggtgatgca ggactgaccc agctttaccg gatgcgcgat       360
     gcgcagttgt ggcgtcacat cgaatttcac cctgaatgca acgcgattta cgcggcactg       420
     gactga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page