(data stored in SCRATCH zone)

EMBL: CP001163.PE36

CP001163.PE36        Location/Qualifiers
FT   CDS_pept        25968..26390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34486"
FT                   /protein_id="ACI34486.1"
FT                   /translation="MYCTVKEIIRDVLDTDVPDSECVFAVVLTRGDVRHIAQDWNLSDD
FT                   ELETVMQRLDDAFEYGADVSIVHDVVRELMEEKRASRQVTVPAVMLEKVMALAGSEMKR
FT                   LYAVGSENGGDGDAFVREEREAMDVVLQALDGEHMS"
     atgtactgta ctgttaaaga aatcatccgc gatgtactgg atacagacgt gccggacagt        60
     gaatgcgttt ttgccgtggt gctgacccgt ggggatgtgc gccacatagc ccaggactgg       120
     aacctgtcag acgatgagct ggaaaccgtc atgcagcggc tggacgatgc ctttgaatat       180
     ggtgcggatg tcagcattgt tcacgacgtt gttcgtgagt tgatggaaga aaagcgtgcc       240
     agccgtcagg tgacagttcc ggcggtgatg ctggaaaaag tgatggcgct ggcaggcagt       300
     gaaatgaagc gcctgtatgc cgtcgggagt gagaacgggg gcgacggtga tgcgttcgtc       360
     agggaggaac gcgaagcaat ggacgttgtg ttacaggcgc tggacgggga gcacatgtca       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page