(data stored in SCRATCH zone)

EMBL: CP001163.PE37

CP001163.PE37        Location/Qualifiers
FT   CDS_pept        26387..26578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34448"
FT                   /protein_id="ACI34448.1"
FT                   /translation="MNISTETREILRNYKAVINARRREMGQKPLTTAQIVDEICDFVAN
FT                   QQAVFLGGHYILQGSRNR"
     atgaatatca gcacagaaac ccgcgaaatt ctgcgcaatt acaaagccgt gattaatgcg        60
     cgacgtcgtg aaatggggca gaaaccgctc accaccgcgc agattgttga tgaaatctgc       120
     gattttgtgg cgaatcagca ggctgttttc ctgggcggtc actacatctt acagggcagc       180
     agaaacaggt ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page