(data stored in SCRATCH zone)

EMBL: CP001163.PE38

CP001163.PE38        Location/Qualifiers
FT   CDS_pept        27212..27340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0059"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34519"
FT                   /protein_id="ACI34519.1"
FT                   /translation="MSGRGSDAPCGEGSQTGEVHTTGNTAAGSRETSKPRLPKLNG"
     gtgtcaggcc gtggcagtga tgccccttgc ggcgaaggtt ctcaaacggg tgaagttcat        60
     accacaggga atacagcagc aggttcccgc gaaacgtcaa aaccgcggct cccgaaactc       120
     aacgggtga                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page