(data stored in SCRATCH zone)

EMBL: CP001163.PE39

CP001163.PE39        Location/Qualifiers
FT   CDS_pept        complement(27403..27552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0060"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34422"
FT                   /protein_id="ACI34422.1"
FT                   /translation="MVNNAVKIGRTILTAWIKQVPDLLFSYLHLTLSGVFLLLFLRSHY
FT                   LSAG"
     ttggttaaca atgccgtcaa aattggtcgc acaattctta cggcgtggat taagcaggtc        60
     cctgacctgc ttttttcata tctgcatctg acgctttccg gtgttttcct ccttctgttc       120
     ctgcgttctc attacctgtc agccggatga                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page