(data stored in SCRATCH zone)

EMBL: CP001163.PE4

CP001163.PE4         Location/Qualifiers
FT   CDS_pept        5883..7322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0020"
FT                   /product="leukotoxin secretion protein D"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01843"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34482"
FT                   /protein_id="ACI34482.1"
FT                   /translation="MRFYMKGLWDLVCRYKTVFSDVWKIRHTLDAPVREKDEYAFLPAH
FT                   LELIETPVSRRSHFVVWSILLFVIISLLLSVLGKVEVVSVANGKFTHSGRSKEIKPIEN
FT                   AIVEKIMVKDGSFVKKNDPLVELTVPGVESDILKSEASLLYEKTEQYRYAILSESIQRN
FT                   ELPEIRITDFPGGEDNAGGEHFQRVSSLIKEQFMTWQNRKNQKQITLNKKIVERDAALA
FT                   RVSLYEHQVSQEGRKLNDFKYLLNKKAVSQHSVMEQENSYIQAKNEHAVWLAQVSQLEK
FT                   EIELVREELALETNIFRSEIIEKHRKSTDNIVLLEHELEKNRQRKASSFIKAPVSGTVQ
FT                   ELNIHTEGGVVTTAETLMIIVPDNDILEVTASVLNKDIGFIQPGQEVVIKVDAYPYTRH
FT                   GYLTGKVKNITADSVSVPDTGLVFNVIISVDRNDIQGERKKIPVTAGMTVMAEIKTGVR
FT                   SVISYLLSPLKETINESLRER"
     atgcgctttt acatgaaagg tttatgggat ttggtttgcc gttataagac ggttttttct        60
     gatgtctgga aaattcgtca cacacttgat gctcctgtga gagaaaaaga tgagtatgca       120
     tttcttcctg ctcaccttga actcattgaa acaccagtat ccagacgttc tcattttgtt       180
     gtatggagta ttttattatt tgtaattata tctcttctct tatctgttct tgggaaagtt       240
     gaagtggttt cagtagcaaa tggtaagttt actcatagtg gaagaagcaa agaaataaaa       300
     ccgatagaga atgcgattgt agaaaaaata atggtaaaag atggctcttt tgtaaaaaaa       360
     aatgatccat tagttgaatt gacggtgcct ggtgttgaat ctgatatttt aaaatcagaa       420
     gcatctttgt tgtatgaaaa aacagaacaa tatcgctacg caattctttc tgaatcaata       480
     caacggaatg agcttcctga aataaggata acagattttc ctggcggaga agataatgcg       540
     ggaggtgaac attttcagag ggttagctca ttaataaaag agcaattcat gacatggcag       600
     aacagaaaaa atcaaaagca gatcacatta aataaaaaaa tagttgaacg ggatgcagcg       660
     cttgctcgtg ttagcctgta tgagcatcag gtatcacagg aaggaagaaa actcaatgat       720
     tttaagtatt tgttgaataa aaaagctgtt tctcaacatt cagttatgga gcaggaaaat       780
     agctatattc aggcaaaaaa tgaacatgca gtctggcttg cacaggtttc tcaacttgaa       840
     aaagaaatag aacttgtgcg ggaagaactg gcactggaga cgaatatctt cagaagtgaa       900
     attatcgaga agcacagaaa atcaacagat aacattgtgt tgctggagca tgagcttgaa       960
     aaaaacaggc agagaaaagc atcatctttt attaaagctc ctgtgagtgg tactgttcag      1020
     gagttaaata tacatacaga aggtggtgtt gtcacaacag cagaaacgct gatgattatt      1080
     gtccctgata atgatattct cgaagtaaca gcatctgtac ttaacaagga tatcggtttt      1140
     atacaacctg gacaggaggt cgttattaaa gtagatgcat atccatatac acgtcatggt      1200
     taccttacag ggaaagtaaa aaatataact gcagattctg tttctgttcc ggatacaggg      1260
     cttgtattta acgtgattat atctgttgat cggaatgata tacagggaga aagaaaaaaa      1320
     atccctgtta cagctggaat gactgttatg gcagaaataa aaaccggggt gcgtagtgtt      1380
     atcagctatc ttcttagtcc attaaaggaa actattaatg aaagtttacg tgaacgttag      1440
//

If you have problems or comments...

PBIL Back to PBIL home page