(data stored in SCRATCH zone)

EMBL: CP001163.PE40

CP001163.PE40        Location/Qualifiers
FT   CDS_pept        27574..27804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34518"
FT                   /protein_id="ACI34518.1"
FT                   /translation="MTVSIVSPSAAAVKPRRHPRFRREDIPAPEIDPVLKAFGRHIARS
FT                   FHRGRGVHIPAMKNTAFGQVLRTLELKRAFN"
     atgactgtaa gcattgtttc accttccgca gcggctgtaa agccccgccg tcatccccgt        60
     ttcagacgcg aagacatccc cgctccggaa attgaccccg tgctgaaagc cttcgggcga       120
     cacatagccc ggagttttca ccgggggcgt ggtgtacaca tccccgccat gaaaaacacg       180
     gctttcgggc aggtgctccg cacactcgaa ctgaaacgcg cttttaactg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page