(data stored in SCRATCH zone)

EMBL: CP001163.PE41

CP001163.PE41        Location/Qualifiers
FT   CDS_pept        27856..29217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0062"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34504"
FT                   /protein_id="ACI34504.1"
FT                   /translation="MTSAAITMTAPEAASPVQMYRATYSPDDNKLRLYAVSRLDPETYK
FT                   KVHDAGFRWAPKQALFVAPAWTPGREDVLLSLAGEIEDEDSTLAERQEARAERFTGYSG
FT                   KRASESAQALDEVERLAAMIPPGQPILVGHHSERRARRDAQRIENGMKRAVMLFERAEY
FT                   WEERGRSALLHAKYKERPDVRWRRIKKIEADLRKAEKTIAQSQKYLTMWRAESLDLNMA
FT                   KLISSHDHISACFPLDTYPRPAEKSQYEGSRSLWSALDDDIITTEQAREIAIRCHERQI
FT                   QHQQRWVNHYQNRLNYERAMLDESGGVVTRTQDFEPGGQVFSRGEWLTIIRVNKSNGAV
FT                   SSVTTPNYSFLGYSGTMKVTPDRITDYKAPSAEEAAVASQAAKRPPVVNYPGEGFREMT
FT                   KAQWAALPRDCKAVRSVAEAEDHGAYRYRRTMDNNFRLVNVYITDMKITEIPQK"
     atgacatcag cagcaatcac catgaccgcc ccggaagccg ccagccctgt gcagatgtac        60
     cgcgcgacct actcaccgga tgacaacaaa ctgcgcctgt atgccgtgtc acgtcttgac       120
     ccggagacgt ataaaaaagt gcatgatgcc ggttttcgct gggcaccaaa acaggcgctg       180
     tttgtcgcgc cggcctggac accgggccgg gaagacgtgc tcctctcact tgccggagag       240
     attgaggatg aagacagcac gctcgctgaa cgtcaggaag cacgggcgga gcggtttacc       300
     ggatacagcg gaaagcgggc cagtgaatcc gcacaggcac ttgatgaagt ggaaagactg       360
     gccgcgatga tcccgcccgg tcagcccatt cttgtggggc atcacagcga acgccgcgcc       420
     cgtcgtgatg cgcagcgtat tgaaaacggc atgaaacgtg ccgtgatgct ctttgaacgt       480
     gcggaatact gggaagaacg ggggcggtca gcactgcttc acgcgaagta taaagaacgt       540
     ccggacgttc gctggcgtcg tatcaaaaaa atcgaagctg atttgcgcaa ggctgaaaag       600
     accatcgcgc agtcgcagaa atatctgacg atgtggcggg ctgaatcgct ggatctgaat       660
     atggcaaaac tcatcagcag tcatgaccat atcagcgcct gtttcccgct ggatacgtat       720
     ccgcgcccgg cagaaaaaag ccagtatgaa gggagccggt cgttatggtc ggccctggat       780
     gatgacatca tcaccacgga gcaggcccgc gaaattgcga tccgctgtca tgaacggcag       840
     attcagcatc agcaacgctg ggttaaccac tatcagaacc gcctgaacta tgagcgtgcc       900
     atgctggacg aaagcggcgg cgtggttacc cggacacagg attttgagcc gggcggacag       960
     gttttcagcc ggggcgagtg gctgaccatc atccgcgtga acaaaagcaa cggggcggtg      1020
     agttcagtca caacgccgaa ttacagtttt ctcgggtaca gcggcacgat gaaagtgacg      1080
     cccgatcgca tcacggacta caaagcacca tcggcagaag aggctgccgt cgccagccag      1140
     gccgcgaagc gtccgccggt agtcaactat ccgggggaag gtttccggga aatgacaaag      1200
     gcacagtggg ccgccctgcc ccgggactgt aaggccgtgc gcagtgtggc agaagcagaa      1260
     gaccacgggg cataccgcta ccgccgcaca atggacaata atttccgtct ggtgaatgtg      1320
     tatatcaccg acatgaaaat tacggaaatc ccacagaaat aa                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page