(data stored in SCRATCH zone)

EMBL: CP001163.PE42

CP001163.PE42        Location/Qualifiers
FT   CDS_pept        29264..29827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0063"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34484"
FT                   /protein_id="ACI34484.1"
FT                   /translation="MHSQLKERIRLMRARLDNAAPVAEIRAESQLFVTPAPVCDRLVTL
FT                   AEISNRDHILEPSAGTGAILRAIRDTAPEAMCDAVEINSGLVRYLRENFNGVRVQCGDF
FT                   MEWQPVQYYSRVIINPPFSHGQDIRHILRAFSLLRPGGVLVAVCLNGPRQQEKLLPFSD
FT                   VREELPRGTFAYTDVPTMIIRLRA"
     atgcacagtc agttaaaaga acgtatccgg ctgatgcgcg caaggctgga taacgccgcg        60
     ccggttgctg aaatccgggc tgaatctcag ctttttgtga ctcctgcccc ggtctgtgat       120
     cgcctggtga cgctggcgga gatcagcaac cgtgatcaca ttctggaacc ctctgccggc       180
     accggggcca tactgcgggc gattcgggat accgcaccgg aggccatgtg tgatgcggtg       240
     gaaatcaaca gcgggctggt ccggtatctg cgggaaaatt ttaacggtgt cagggttcag       300
     tgtggcgact tcatggaatg gcagccggtg cagtattaca gccgggttat cattaatccg       360
     ccgttcagcc acgggcagga tatccggcat atcctgcggg ccttttccct gttgcgtccg       420
     ggtggcgtgc tggtcgccgt ctgtctgaac gggccgcgcc agcaggagaa gctgttaccg       480
     ttttctgacg tccgcgagga gctgccacgc ggcacgtttg cttataccga tgttccgacg       540
     atgattattc gtctgcgtgc ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page