(data stored in SCRATCH zone)

EMBL: CP001163.PE43

CP001163.PE43        Location/Qualifiers
FT   CDS_pept        30495..30656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0065"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34442"
FT                   /protein_id="ACI34442.1"
FT                   /translation="MRSAPGQSFPAVAVMPLAAKVLKKVMVNTGGNKRQVPAKRQNRGS
FT                   RNSKDDGG"
     ttgcggtctg cccccggaca gtcgtttccg gccgtggcag tgatgcccct tgcggcgaag        60
     gttctcaaaa aggtgatggt gaataccgga gggaacaaaa ggcaggtccc cgcaaaacgt       120
     caaaaccgcg gctcccgaaa ctcaaaagat gatgggggct ga                          162
//

If you have problems or comments...

PBIL Back to PBIL home page