(data stored in SCRATCH zone)

EMBL: CP001163.PE44

CP001163.PE44        Location/Qualifiers
FT   CDS_pept        30682..31134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0066"
FT                   /product="single-strand binding protein"
FT                   /note="identified by match to protein family HMM PF00436;
FT                   match to protein family HMM TIGR00621"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34516"
FT                   /protein_id="ACI34516.1"
FT                   /translation="MAVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDKQ
FT                   TGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSWEDNGITRYVTEILVK
FT                   TTGTMQMLVRAAGAQTQPEEGQQFSGQPQPQPPEGDDYGFSDDIPF"
     atggcagttc gtggcattaa caaggtcatc ctcgtaggac gcctgggaaa agatccggaa        60
     gtccgttaca tccccaacgg gggcgcagtg gcaaacctgc aggtggccac gtcagaaagc       120
     tggcgtgaca aacagacggg ggagatgcgg gagcagacag aatggcatcg cgtggtgctg       180
     ttcggcaagc tcgcggaagt ggcaggtgaa tatctgcgca agggcgcgca ggtctacatc       240
     gaaggtcagc ttcgcacccg tagctgggag gataacggta tcacccgtta cgtcaccgaa       300
     attcttgtta agaccacggg caccatgcag atgctggtac gtgccgcagg tgctcagact       360
     cagccggaag aggggcaaca gttcagcggt cagcctcagc cgcaaccgcc ggagggtgac       420
     gattacgggt tttcagacga tatcccgttc tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page