(data stored in SCRATCH zone)

EMBL: CP001163.PE45

CP001163.PE45        Location/Qualifiers
FT   CDS_pept        31191..31424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06006"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34521"
FT                   /protein_id="ACI34521.1"
FT                   /translation="MSEYFRILQGLPDGPFTRKHAEAVAAQYRNVFIENDHGEQFRLVV
FT                   RNNGAMVWRTWNFEDGAGYWMNHVIRDFGIIK"
     atgagcgaat atttcagaat acttcaggga ctgcctgacg gtccttttac ccgcaaacat        60
     gccgaagccg ttgccgcaca gtaccggaac gtctttatcg agaatgacca cggcgaacag       120
     tttcgcctgg ttgtccgtaa taacggtgca atggtctggc gtacctggaa ttttgaggac       180
     ggtgccgggt actggatgaa ccatgtcatc cgtgatttcg ggattattaa gtaa             234
//

If you have problems or comments...

PBIL Back to PBIL home page