(data stored in SCRATCH zone)

EMBL: CP001163.PE46

CP001163.PE46        Location/Qualifiers
FT   CDS_pept        31490..33448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0068"
FT                   /product="plasmid partition protein B"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34501"
FT                   /protein_id="ACI34501.1"
FT                   /translation="MSVTESKAKTERKSSRKPAKTQETVLSALLAQTEEVSVPLASLIK
FT                   SPLNVRTVPYSAESVSELADSIKGVGLLQNLVVHALPGDRYGVAAGGRRLAALNMLAER
FT                   DIIPADWPVRVKVIPQELATAASMTENGHRRDMHPAEQIAGFRAMAQEGKTPAQIGDLL
FT                   GYSPRHVQRMLKLADLAPVILDALAEDRITTEHCQALALENDTARQVQVFEAACQSGWG
FT                   GKPEVQTIRRLVTESEVAVAGNSKFRFVGADTFSPDELRTDLFSDDEGGYVDCVALDAA
FT                   LLEKLQAVAEHLREAEGWEWCAGRMEPVGFCREDAGTYRSLPEPEAVLTEAEEERLNEL
FT                   MARYDALENQCEESDLLEAEMKLMRCMAKVRAWTPEMRAGSGVVVSWRYGNVCVQRGVQ
FT                   LRSEDDVADNDYRTEQVQEKASVEEISLPLLTKMSSERTLAVQAALMQQSDKSLALLAW
FT                   TLCLNVFGSGAYSNPARIRLECEHYSLTSDAPSGKEGAAFMAMMAEKARLAALLPDGWA
FT                   RDMTTFLSLSQEVLLSLLSFCTACSIHGVQTREYGHTSRSPLDTLESAIGFHMRDWWQP
FT                   TKANFFGHLKKPQIIAALNEAGLSGAARDAEKMKKGDAAEHAEHHMKDNRWVPGWMCAP
FT                   RPQTDATERTDNLADAA"
     atgtcagtta cagagtctaa ggcaaaaacg gagcgtaaat ccagccgtaa acctgcaaaa        60
     acgcaggaaa cagtcctgtc ggccctgctg gcgcagacgg aggaagtgag cgtgccgctg       120
     gcctcgctga ttaagtcacc gctgaatgtg cgcacggtgc cgtattctgc ggagtccgtc       180
     agcgaactgg cggactccat taaaggtgtc ggcctgttac agaatctggt tgttcatgcc       240
     ctgccaggtg accgttacgg tgtcgccgca ggtggtcgcc gactggcagc actcaacatg       300
     ctggcagagc gtgacatcat tccggctgac tggcctgtcc gtgtgaaggt cattccgcag       360
     gagctggcga ctgccgcatc gatgaccgag aacggtcatc gtcgggatat gcaccctgcc       420
     gaacagattg ccggattccg tgcaatggcg caggaaggca aaacacctgc acaaatcggt       480
     gatttgctgg gttattcgcc ccgccacgtt cagcgaatgc tgaaactggc agaccttgcg       540
     cctgtcatcc tcgatgcgct ggcagaagac cgcatcacca ccgagcactg tcaggcgctg       600
     gcgctggaga acgacaccgc gcgtcaggtg caggtgtttg aagccgcctg tcagtcggga       660
     tggggcggta aaccggaagt acagaccatt cgtcgtctgg tgaccgaaag tgaagtggcg       720
     gtggcaggga acagtaaatt ccgcttcgtg ggggctgata ccttctcgcc agatgaactg       780
     cgcaccgatt tgttcagtga cgacgagggt ggctatgtgg actgcgtggc gctcgatgcc       840
     gccctgctgg aaaaactcca ggctgtcgcc gaacaccttc gggaagccga aggctgggaa       900
     tggtgcgccg gacgtatgga gcctgttggt ttctgccgtg aggatgccgg aacataccgc       960
     agtctgccgg agccggaagc ggtgctgacg gaggcagaag aagaacgcct gaacgaactg      1020
     atggcacgtt acgatgcgct ggaaaaccag tgtgaggaat ccgacctgct ggaagccgaa      1080
     atgaagctga tgcgctgcat ggcgaaggtc agggcgtgga cgccggagat gcgtgccgga      1140
     agtggcgtgg tggtgtcctg gcgttatggc aacgtgtgtg tccagcgtgg tgtgcagttg      1200
     cgcagtgagg atgatgtggc tgataacgat taccgcacgg aacaggtgca ggagaaagcc      1260
     tcagtggagg aaatcagtct gccgctgctg acgaaaatgt cctcagagcg cacgctggca      1320
     gtccaggcgg cactgatgca gcaatcagac aaatccctgg cacttctggc atggacactc      1380
     tgtctgaatg tatttggcag tggagcgtac agcaatcccg ccagaatccg cctggaatgt      1440
     gagcattatt cgctgaccag cgatgcgccg tcagggaagg aaggtgccgc attcatggcg      1500
     atgatggcag aaaaagcccg tcttgccgcc ctgctgccgg atggatgggc acgggatatg      1560
     acgacgttcc tgtcactcag tcaggaggtg ctgttatcac tgctcagttt ctgcaccgcg      1620
     tgcagtatcc acggtgtcca gacccgtgag tatggtcaca cgtcacgcag tccgctggac      1680
     acgctggaga gcgccatcgg ctttcacatg cgcgactggt ggcagccgac gaaagcaaac      1740
     tttttcggac acctgaaaaa gccgcagatt atcgcagccc tgaatgaggc aggactatcc      1800
     ggtgccgcac gggacgcgga gaagatgaag aaaggcgatg cggctgaaca tgcagagcac      1860
     catatgaaag acaaccgctg ggtgcctggc tggatgtgtg caccacgccc acagacggat      1920
     gccactgaac gcaccgataa cctggctgat gccgcctga                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page