(data stored in SCRATCH zone)

EMBL: CP001163.PE47

CP001163.PE47        Location/Qualifiers
FT   CDS_pept        33503..33937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0069"
FT                   /product="plasmid SOS inhibition protein"
FT                   /note="identified by match to protein family HMM PF06290"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34509"
FT                   /protein_id="ACI34509.1"
FT                   /translation="MKTELTLNVLHTMNAQEYEDIRAAGSDARRELTHAVMRELDAPDN
FT                   WTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVVQV
FT                   QRRFAPEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQV"
     atgaaaactg aactgactct gaatgtatta cataccatga acgcacagga atatgaagat        60
     atccgggctg ccggaagtga tgcacgccgt gagctgacac acgccgtgat gcgggagctg       120
     gatgcgccgg acaactggac gatgaacggc gagtacggca gcgagtttgg cggctttttc       180
     cccgtccagg tccgtttcac gcctgcccac gaacgttttc acctggcgtt atgttcaccg       240
     ggcgatgtct cccaggtctg ggtgctggtt ctggtgaatg ccggtggtga gccgtttgcg       300
     gtggttcagg tacagcggcg gtttgcaccg gaagccgtca gccattcact ggcactggcg       360
     gcgtcactgg atacgcaggg atacagcgtt aacgacatca tccatatcct gatggcggaa       420
     ggaggtcagg tatga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page