(data stored in SCRATCH zone)

EMBL: CP001163.PE48

CP001163.PE48        Location/Qualifiers
FT   CDS_pept        33934..34695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0070"
FT                   /product="putative PsiA protein"
FT                   /note="identified by match to protein family HMM PF06952"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34438"
FT                   /protein_id="ACI34438.1"
FT                   /translation="MSARSQALVPLSTEQQAAWRAVAETEKRRNQGNTLAEYPYAGAFF
FT                   RCLNGSRRISLSDLRFFMPSLTAEELHGNRLQWLYAIDVLIETQGEVCLLPLPGDAAER
FT                   LFPSVRFCVRERSRHKSALVMQKYSRQQAREAEQKARAYQALVAQAEIELAFHSPETVG
FT                   SWYARWSDRVAEHDLETLFWQWGERFPSLAGMERWQWQDMPFWQVIAEASLAAKEAGHA
FT                   VREMERWMVPNKLREVRDAATITRIARKQPE"
     atgagcgcac gttcacaggc actggttccc ctcagcacag agcaacaggc cgcatggcgg        60
     gcagtggcag agacggaaaa acgccgcaat cagggaaaca cgctggcgga atatccgtat       120
     gcgggggcgt ttttccgctg tctgaacgga agccgcagga tatcgctgtc tgacctgcga       180
     tttttcatgc cgtccctgac cgcagaagaa ctgcacggaa accgtcttca gtggttgtat       240
     gccatcgatg tgctgattga aacacagggc gaggtctgcc tccttcccct tcccggtgat       300
     gcagcagaac gcttgttccc gtcggtgcgg ttttgtgtca gggaacgcag tcgccataaa       360
     tccgcgctgg tcatgcagaa gtacagccgc cagcaggcga gggaggcaga gcagaaagcc       420
     cgtgcgtacc aggcgctggt cgcccaggct gaaatcgaac tggcgttcca ttcaccggaa       480
     acagtcggaa gctggtatgc acgctggagt gatcgggtgg cagagcatga cctggaaacc       540
     ctgttctggc agtggggcga gcgttttccg tcactggccg gaatggaacg ctggcagtgg       600
     caggatatgc cattctggca ggttatcgcg gaagccagtc tggcagcaaa ggaggccggt       660
     catgctgtcc gtgagatgga gcggtggatg gtgccgaaca aactccggga ggtgcgtgat       720
     gcggcaacaa tcacacggat tgcccgtaaa cagcctgaat ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page