(data stored in SCRATCH zone)

EMBL: CP001163.PE5

CP001163.PE5         Location/Qualifiers
FT   CDS_pept        complement(7898..8095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECH74115_B0023"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:ECH74115_B0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACI34459"
FT                   /protein_id="ACI34459.1"
FT                   /translation="MHLKYVQNPHSVTLIFLTRKKRGNNQYLSPLHNCRIINYKNKNSG
FT                   FIYMITCNITEKYFEIKPFC"
     atgcacctga aatacgttca aaatccacat agcgtaactc tgattttcct taccagaaaa        60
     aagaggggga ataaccagta tctatccccc ctacacaatt gcagaataat aaattataaa       120
     aataagaact caggatttat atacatgatt acatgtaata ttactgagaa atattttgag       180
     ataaaacctt tttgctga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page